KEGG   Weeksella virosa: Weevi_0439Help
Entry
Weevi_0439        CDS       T01441                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
wvi  Weeksella virosa
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Weevi_0439
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Weevi_0439
Enzymes [BR:wvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Weevi_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(435879..436466)
Genome map
AA seq 195 aa AA seqDB search
MLKYGIIGLLSFSFLACNAQNKEISSPKKIENQMTRPTIYQYSFEDINGEAFNFVDLKGK
KILIINTASKCGFTSQFETLEKIYKQYKDQNFVIVGFPSDNFLNQEYDDNKKIAEFCQLN
YGVTFPMMSKSDVKGKNQNQIFSFLTQKELNGVEDAKVGWNFHKFLINEDGTLETNYPSK
VTPDSKEIIGWIEKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtacggaataatcggtttattgagtttctcttttttagcttgtaacgcacaa
aacaaagaaatttcatcaccaaaaaaaatagaaaatcaaatgacacggccaacaatttat
caatacagtttcgaggatatcaacggagaagctttcaattttgtcgacctcaaaggaaaa
aaaatattaataatcaataccgcgtccaaatgtggatttacatcgcaattcgaaacgctc
gaaaaaatttataaacaatacaaagatcaaaactttgtaatcgttggttttccttcggat
aatttcttgaatcaagaatacgatgataataaaaaaattgccgaattctgtcaactcaac
tatggtgtaactttcccaatgatgagtaaaagtgatgtgaaagggaaaaaccaaaatcaa
atttttagttttcttacacaaaaagaattaaacggtgtagaagatgccaaagtaggatgg
aattttcataaatttttgatcaatgaagacggtaccttagaaaccaactatccatcaaaa
gtaaccccagatagtaaagaaattatcggttggatagaaaaaaagtaa

DBGET integrated database retrieval system