KEGG   Weeksella virosa: Weevi_0541Help
Entry
Weevi_0541        CDS       T01441                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
wvi  Weeksella virosa
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:wvi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(545328..545945)
Genome map
AA seq 205 aa AA seqDB search
MSNYPSKVLERAVNEMSQLPGIGKRTALRLVLHMLNRPHTQTLRLAEALTHLVEDIQYCE
TCHTLSDTPICEICSNPLRDHSIICVVEDVRDVMAIENTGQYRGVYHVLGGRISPMEGIG
PSQLKIDSLVKRAAEESTKEIIFALSSTMEGDTTVFYLFKQLKDFPLFYTTIARGIGVGD
ELEYADEATLIRSIENRIPYSETKL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattatcccagtaaagttttagagcgagcggttaatgagatgtctcaactgcct
ggtattggtaaaagaactgctttgcgcctggtcttgcatatgctcaacaggccacataca
cagacacttcgattggcagaagcgctcacacatttggttgaggatatacaatattgcgaa
acttgtcatacgttatcggatacaccaatttgcgaaatttgtagcaatcctttgcgcgat
catagtatcatttgtgtggtagaagatgtgcgagatgtgatggcgatcgaaaatacgggt
caatatcgaggagtttaccatgttttgggagggcgtatttctcctatggaaggaattggg
ccttctcagctaaaaatcgattcactggtaaaaagagcggctgaagaatcgaccaaagag
attatttttgccttaagttctacgatggaaggagatacaactgttttttatttattcaaa
cagttaaaagattttcctttattttacactacaatagcaagaggaattggggtaggagat
gagttggagtatgccgatgaagcaacgctgattcgttctatcgaaaatagaattccctat
tcagaaaccaaattataa

DBGET integrated database retrieval system