KEGG   Weeksella virosa: Weevi_0583Help
Entry
Weevi_0583        CDS       T01441                                 

Definition
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
wvi  Weeksella virosa
Pathway
wvi02024  Quorum sensing
wvi03060  Protein export
wvi03070  Bacterial secretion system
Module
wvi_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Weevi_0583
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Weevi_0583
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Weevi_0583
Secretion system [BR:wvi02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Weevi_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC
Motif
Other DBs
NCBI-ProteinID: ADX67302
UniProt: F0NZP3
Position
complement(593928..594245)
Genome map
AA seq 105 aa AA seqDB search
MTSSIFLQAGAEGGGWGTLLLFGGMFIIMYFFMIRPTMQRQKKEKLFQDEVKVGDQVVTT
SGIHGRIGQLSDDHFILETGAGKIKMERTAISKELTTARYKTIEK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatcaatttttttacaagcaggcgctgaaggaggaggatggggaacattgctg
ctttttggtggaatgttcatcataatgtacttctttatgattcgtccgactatgcaaaga
caaaaaaaagaaaaactatttcaagacgaggtaaaagtcggtgatcaggtggtaacgacc
tctgggattcatggtagaataggacaattgtctgatgaccattttatcctagaaactggt
gcagggaaaataaaaatggagcgtaccgcaatctcaaaagagttgacaactgcacgttac
aaaactatagaaaaataa

DBGET integrated database retrieval system