KEGG   Weeksella virosa: Weevi_0583Help
Entry
Weevi_0583        CDS       T01441                                 

Definition
preprotein translocase subunit YajC
Orthology
K03210  
preprotein translocase subunit YajC
Organism
wvi  Weeksella virosa
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Weevi_0583
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Weevi_0583
Secretion system [BR:wvi02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   Weevi_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(593928..594245)
Genome map
AA seq 105 aa AA seqDB search
MTSSIFLQAGAEGGGWGTLLLFGGMFIIMYFFMIRPTMQRQKKEKLFQDEVKVGDQVVTT
SGIHGRIGQLSDDHFILETGAGKIKMERTAISKELTTARYKTIEK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatcaatttttttacaagcaggcgctgaaggaggaggatggggaacattgctg
ctttttggtggaatgttcatcataatgtacttctttatgattcgtccgactatgcaaaga
caaaaaaaagaaaaactatttcaagacgaggtaaaagtcggtgatcaggtggtaacgacc
tctgggattcatggtagaataggacaattgtctgatgaccattttatcctagaaactggt
gcagggaaaataaaaatggagcgtaccgcaatctcaaaagagttgacaactgcacgttac
aaaactatagaaaaataa

DBGET integrated database retrieval system