KEGG   Weeksella virosa: Weevi_0583Help
Entry
Weevi_0583        CDS       T01441                                 

Definition
preprotein translocase subunit YajC
Orthology
K03210  
preprotein translocase subunit YajC
Organism
wvi  Weeksella virosa
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:wvi03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:wvi03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(593928..594245)
Genome map
AA seq 105 aa AA seqDB search
MTSSIFLQAGAEGGGWGTLLLFGGMFIIMYFFMIRPTMQRQKKEKLFQDEVKVGDQVVTT
SGIHGRIGQLSDDHFILETGAGKIKMERTAISKELTTARYKTIEK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatcaatttttttacaagcaggcgctgaaggaggaggatggggaacattgctg
ctttttggtggaatgttcatcataatgtacttctttatgattcgtccgactatgcaaaga
caaaaaaaagaaaaactatttcaagacgaggtaaaagtcggtgatcaggtggtaacgacc
tctgggattcatggtagaataggacaattgtctgatgaccattttatcctagaaactggt
gcagggaaaataaaaatggagcgtaccgcaatctcaaaagagttgacaactgcacgttac
aaaactatagaaaaataa

DBGET integrated database retrieval system