KEGG   Weeksella virosa: Weevi_0626Help
Entry
Weevi_0626        CDS       T01441                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
wvi  Weeksella virosa
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Weevi_0626
Enzymes [BR:wvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Weevi_0626
    3.5.1.-  
     Weevi_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635765..636367
Genome map
AA seq 200 aa AA seqDB search
MKALIIVDLQYDFLPGGKLAVPHGDEIIKRINELQAKFELIIATQDWHPEKHQSFASQHP
NNQVLDIVDLQGYPQTLWPDHCVQGTKGAELSHELHQNKLSAIIRKGMNPSIDSYSAFFD
NNHQRKTGLHGYLQEQGVTEIFVCGLAADFCVYFTAMDALKLGYKVHILERAVKAIDNEM
YQEKLKTFITKGGQLTSYLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattaatcattgtcgatttacagtacgactttttaccaggtggtaaattggcc
gttcctcatggagatgaaatcatcaaacgcatcaacgaattgcaagccaagttcgagctg
attattgccacccaagattggcaccccgaaaaacaccaaagttttgcatctcaacatccg
aacaatcaagttttggatattgtcgatttgcaaggttatccgcaaacactatggccagat
cattgtgtgcaaggaacaaaaggcgcagagttgagccacgaattacatcagaacaaactt
tccgcaatcatccgaaaaggcatgaatccttcgatcgattcgtacagtgcttttttcgat
aataaccatcaacgcaaaactggcttacacggctacttacaagaacaaggcgtaaccgaa
atttttgtatgcggtttggctgctgatttttgtgtctatttcaccgccatggacgcactg
aaattgggatacaaagttcatattctcgagcgtgccgtaaaagcgattgataatgaaatg
taccaagaaaaactaaaaacatttattaccaaaggcggacaactcacaagctatttggat
taa

DBGET integrated database retrieval system