KEGG   Weeksella virosa: Weevi_0675Help
Entry
Weevi_0675        CDS       T01441                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
wvi  Weeksella virosa
Pathway
wvi00020  Citrate cycle (TCA cycle)
wvi00640  Propanoate metabolism
wvi00660  C5-Branched dibasic acid metabolism
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
wvi01120  Microbial metabolism in diverse environments
wvi01130  Biosynthesis of antibiotics
wvi01200  Carbon metabolism
Module
wvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Weevi_0675
   00640 Propanoate metabolism
    Weevi_0675
   00660 C5-Branched dibasic acid metabolism
    Weevi_0675
Enzymes [BR:wvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Weevi_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF2711 Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: ADX67390
UniProt: F0P043
Position
693958..695148
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQAKQILSKYGVKVQRGIVATTPDEAVEAAQELTKETGTSWHVVKAQIHAGGRGK
GGGVKLAKSLEEVKEKATDIIGMQLITPQTPPEGKKVNQVLIAEDVYYPGESEIEEFYVS
VLLNRATGRNMFMYSTEGGMDIEAVAEATPEKIFTEEIDPAVGLTGFQAANIAFNLGVKG
AAYKDMIKFIHALYNAYIGIDASLFEINPVLKTSDDQIMAVDAKVVLDGNALFRHKDLAE
LRDTREEDPTEVEADAAGLNFVKLDGNVGCMVNGAGLAMATMDIIKLSGGNPANFLDVGG
TADAERVEKAFRIILKDSNVKGILVNIFGGIVRCDRVAQGILDAYKNLGDSINVPIIVRL
QGTNADIARQMISESGLQVHAVDTLQDAADKVAEIL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgaatatcaagcaaaacaaattttaagtaagtatggtgttaaagtacaa
cgaggaatagttgcaacaacaccagatgaagctgttgaagctgcacaagagttaaccaaa
gaaacgggcacatcttggcatgttgtaaaagcccaaatccacgcaggtggacgcggtaaa
ggtggcggagtaaaacttgctaaaagtttagaagaagtaaaagaaaaggctacggatatt
atcggtatgcaattgataaccccacaaactccaccagaaggaaagaaagtaaatcaggta
ttaatcgctgaagatgtttactatcctggagaatctgaaatagaagaattctacgtttca
gtattattaaaccgtgcaactggaagaaatatgtttatgtattcaaccgaaggggggatg
gatatcgaggcagttgcagaagctactccagaaaaaatcttcaccgaagaaattgaccct
gcagttggtttaacaggtttccaagctgcaaatattgccttcaacttgggtgtaaaagga
gcagcttacaaagacatgataaagtttattcatgcactttacaatgcttatattgggatt
gacgcttcattgttcgagatcaacccagtactgaaaacatcagacgaccaaattatggcg
gttgatgcaaaagttgttttggatggtaacgcattattccgtcataaagacttagcagaa
ttacgtgacactcgagaagaagatcctaccgaagtagaagctgatgcagcgggattaaac
tttgtgaagttagacggaaacgttggttgtatggtaaatggtgctggtttagcgatggca
acaatggatatcattaagctttctggaggaaacccagccaacttcctagacgtaggagga
actgcagacgcagaacgtgtagaaaaagcattccgtattatcctgaaagattccaacgta
aaaggaatcttggtaaatatctttggaggaatcgttcgttgtgaccgagttgctcaagga
attttggatgcatacaaaaacttaggtgactcgattaatgtacctatcattgtacgatta
caaggtaccaatgccgatattgcaagacaaatgattagcgaatctggtttacaagtacat
gcagtagacactttacaagatgctgccgacaaagtagctgaaatactgtaa

DBGET integrated database retrieval system