KEGG   Weeksella virosa: Weevi_0717Help
Entry
Weevi_0717        CDS       T01441                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wvi  Weeksella virosa
Pathway
wvi00020  Citrate cycle (TCA cycle)
wvi00310  Lysine degradation
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
wvi01120  Microbial metabolism in diverse environments
wvi01130  Biosynthesis of antibiotics
wvi01200  Carbon metabolism
Module
wvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Weevi_0717
  Amino acid metabolism
   00310 Lysine degradation
    Weevi_0717
Enzymes [BR:wvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Weevi_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF5386
Motif
Other DBs
NCBI-ProteinID: ADX67432
UniProt: F0P0E8
Position
complement(738352..739653)
Genome map
AA seq 433 aa AA seqDB search
MADYKLILPSMGEGVMEATVTNWLKNIGDTIAEDESVVEIATDKVDSDLPSPVSGTLKEI
LVQVDEVAKVGEPVAILEVDGEVEQEEVVQASETIEKDIDQLKQSVTTSQENPVQEVVSS
ADRFYSPLVKSIAKEEGISQTELDQIHGTGLEGRVTKDDLKKYLETRGQQPKIESTTQAA
TSQQSISPATAPVMTVSGEDEIIEMDRMRKIIAKNMVQAKQIAPHVTSFIEADLTNIVLW
REKNKKAFEAKYGEKITYMPIFIQAITKAILDFPMINVSVDGERIIKKKNINIGMAAALP
SGNLIVPVIKNADQYSLSGLAKKVNDLANRARQNKLKPDEIQGGTYTITNIGSFGNTLGT
PIIPQPQVAIMAVGAIVKKPAVIETPQGDMIGIRHKMYLSHAYDHRVVDGALGGMFVKRV
AEYLENFDMDAEI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcggattataaactgatattaccttcgatgggagaaggtgttatggaagcaacagta
accaattggttgaaaaatattggcgatacaattgccgaagacgaatcggtagtagaaata
gctacagataaagtagattcggatttgccttcaccagttagtggtactttaaaagaaatt
ttagttcaggttgatgaagttgcaaaagtaggtgaaccagttgcaattttagaagtcgat
ggagaagttgaacaagaagaagtagtacaagcaagtgaaactatagaaaaagatatagac
caactaaaacaatcggtaacaactagccaagaaaaccctgtacaagaagtagtttcgtct
gctgatcgtttctattctcctttggtgaaatcgattgccaaagaagaaggcatctcacaa
acagaattggatcaaattcatggaacaggtctcgagggacgtgtaaccaaagatgatcta
aaaaaatatttagaaactcgcggtcaacaaccaaagatagaatcaacaacacaagctgct
acaagtcaacaatcaatttctccagcaactgctccagtgatgacagtttcgggtgaagat
gaaattatcgagatggatagaatgcgtaaaataattgcgaaaaatatggtacaagccaaa
caaattgcacctcatgtaacgtctttcatcgaagctgatttaacgaacattgttctgtgg
agagagaaaaacaagaaagctttcgaagcaaagtatggcgagaagattacctatatgcca
attttcatccaggcaataacaaaggcaattctcgatttcccgatgatcaatgtttcggta
gatggtgaacgaatcattaaaaagaaaaatattaatattgggatggctgccgcattacca
agtggcaatctcatcgtaccagtcatcaaaaatgcagaccaatacagtttatctggcttg
gctaagaaagtaaacgatttggcgaatagagctcgtcagaacaaattaaaaccagacgaa
attcagggtggcacttatacgataaccaatataggatctttcggtaacaccctagggacg
ccgattattcctcagccgcaagtagccattatggcggtaggagcaatcgtgaagaaacct
gctgttattgaaactccacaaggagatatgatcggtattcgacataaaatgtatctatca
catgcgtatgatcatcgtgtggtagatggtgctttgggtggaatgtttgtgaagcgggtg
gccgaatatttagaaaattttgatatggatgcagaaatctaa

DBGET integrated database retrieval system