KEGG   Weeksella virosa: Weevi_0931Help
Entry
Weevi_0931        CDS       T01441                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
wvi  Weeksella virosa
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Weevi_0931
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Weevi_0931
Enzymes [BR:wvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Weevi_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980426..981220
Genome map
AA seq 264 aa AA seqDB search
MQTYLDQIIQLKKQEVEQAKIQQPIHLLQQQALYKRHKISAKKAIVDPDKTGIIAEFKRK
SPSKGYIHKNALVESIIPQYEKAGASMISILTDRPFFGAQTDDFSQARELSTIPLLRKEF
IIDAYQLHESKAMGADVILLIASCLGKKEIATFTQIAHDLDMEVLLEIHTEKQLETYSTD
IDLVGINNRNLETFEVDLAHSRKLLTQLPAESIKIAESGLNSPETVLALKEERFHGFLIG
EHFMKTDNPGKSFAQFNNEIKQTK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacctatttagaccaaataattcaactaaaaaaacaagaagtcgaacaagcaaaa
attcaacaaccgattcatcttctccaacaacaagcgttgtacaaaagacacaagatttcg
gctaaaaaagcgattgtcgatcctgataaaactggaattattgccgagttcaaacgcaaa
tctccctcaaaaggttatatccataaaaatgccttggtagagagtataattccgcaatac
gaaaaagcaggcgcttcgatgatttctatccttacggatcgtccgttttttggtgcacaa
accgatgatttttcacaagcaagagaactgagtacaattccattattacgaaaagaattt
attatagatgcctatcagctacacgaatccaaggcaatgggagctgatgttatcttgttg
attgcctcttgtttgggcaaaaaagaaattgcaactttcactcaaatcgctcatgatttg
gatatggaggttttactagaaattcataccgagaaacaattggaaacgtattcaaccgac
attgatttggtcggaatcaataatcgaaatcttgaaactttcgaggtagatttagcacat
tctcgaaagcttttgactcaacttcctgccgagagcattaagattgccgaaagtggactc
aattctcccgaaactgttttagccctaaaggaagaaagattccatggttttttgataggc
gaacattttatgaaaaccgacaatccgggcaaaagttttgcacaatttaataatgaaata
aaacaaaccaaatga

DBGET integrated database retrieval system