KEGG   Weeksella virosa: Weevi_1093Help
Entry
Weevi_1093        CDS       T01441                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
wvi  Weeksella virosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Weevi_1093
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Weevi_1093
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Weevi_1093
Enzymes [BR:wvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Weevi_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1154716..1155489
Genome map
AA seq 257 aa AA seqDB search
MNTLDQLFKHKKNNLLAIYFTAGYPKLDDTPKIIKALEKSGSDLIEVGIPYSDPLADGSV
IQKTSEQALKNGLTIDVLFQQLASVQPLQTPILLMGYYNQLMKYGLEKFLQNCKKTNVSG
LIIPDMPVEIYQEQHQAMFEAYDQKVVFLVTPKTSEERAQKLIDGTTGFVYIVSNSATTG
TSNSAYNESFLKRIKEKQLSKPSLVGFGIATATDYQKATKFANGAIIGSAFLKMLGESEN
LDQAIEQFIYSIKTKEA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattagatcaacttttcaaacataaaaagaacaatttactagcaatctatttt
actgcaggatatcccaaacttgacgatactcccaagataatcaaagctttggagaaaagt
ggatcagaccttatcgaagttggtattccttattcggatccattagcagatggatcggtg
atacagaaaaccagcgaacaagccctgaagaatgggctcactatcgacgtactttttcag
caattggcaagcgttcaacctttacaaacgcctatattattgatgggatattataatcaa
ttgatgaaatatggattggaaaagtttctacaaaactgtaaaaaaacaaacgtatctggt
ttgattattcctgatatgcctgtagaaatatatcaagaacaacatcaagctatgttcgaa
gcctatgaccagaaagtagtgtttctcgttacacctaaaacttctgaagagcgtgcgcaa
aaattaattgatggcacaactggtttcgtatatattgtatcgaattctgcgacaaccgga
accagtaatagtgcttataacgaaagtttcctaaagagaatcaaagaaaaacagttgtcg
aagccgagtttggtaggtttcggaattgcaactgctaccgattaccaaaaagcaactaag
tttgcaaacggagccataatagggagtgcatttcttaaaatgctcggcgaaagtgaaaat
ctggatcaagctatcgaacaatttatttattccataaaaacaaaggaagcttag

DBGET integrated database retrieval system