KEGG   Weeksella virosa: Weevi_1185Help
Entry
Weevi_1185        CDS       T01441                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
wvi  Weeksella virosa
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1249111..1249758
Genome map
AA seq 215 aa AA seqDB search
MPVDEFKHKGKRKQLMELLYRKGIEDEKVLKAMNNIPRHLFIDSAFEEFAYRDEAFPIAS
GQTISHPYTVAFQTSLLHVHEGEKVLEIGTGSGYQTAVLVELGAEVFSIERQKELYDFSR
LILNKINKKPRYQTFGDGYKGLPAFAPFDKIIVTAGAPYLPEELLKQLKLGGIMVIPIGK
ENQKMYTYLRLDDHNFEVLEFGDYQFVPMLENTKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgccagtagatgaatttaagcacaaaggaaaacgaaaacagctgatggagttgttgtat
cgtaaaggaattgaagatgaaaaggttctgaaagcgatgaataatatccctagacatctt
tttatagatagtgctttcgaagagtttgcttaccgcgacgaagccttcccgattgcctct
gggcagactatctctcacccttatacggttgcttttcagacttcgctgttgcatgtgcac
gaaggcgaaaaagtgttagaaattggtacaggtagtggataccaaacagcagttttggta
gaattaggtgccgaagttttttcgatagaaagacaaaaagagttgtatgatttctctaga
cttattcttaataaaataaataaaaaaccacgataccaaacatttggtgacggatataaa
ggtctacctgcatttgccccgttcgataaaataatcgtaacggctggtgcaccttattta
ccagaagaattactgaaacagctgaaattaggtggaattatggtgatcccaatcggaaaa
gaaaatcagaaaatgtatacatatcttcggttggatgatcataattttgaggtattagaa
tttggtgattatcaatttgttccgatgctggagaataccaaaaaataa

DBGET integrated database retrieval system