KEGG   Weeksella virosa: Weevi_1190Help
Entry
Weevi_1190        CDS       T01441                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
wvi  Weeksella virosa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Weevi_1190
Enzymes [BR:wvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Weevi_1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1257930..1258604
Genome map
AA seq 224 aa AA seqDB search
MCDKHIDELADEHIMTNLETPLRADAFDLAVDEKVKLIEDDFKKIMLTLGLDLTDDSLKG
TPKRVAKMFVKEIFGGLLPENRPGMSTFENKYNYNQMLVEKDIVVYSTCEHHFLPIVGRA
HVAYISKGRVIGLSKMNRIVDYFAKRPQVQERLTMQVVKALQDALGTEDVACVIDAKHLC
VNSRGIRDIESSTVTAEYGGQFKKDENLRKEFLSYLRLNTTFNV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgataaacatatagacgaattggcagatgagcatatcatgaccaatttagaaacg
cctttgcgcgctgacgctttcgatcttgcggtagacgaaaaggtaaagttgatagaagac
gattttaaaaaaattatgttgacgctaggtctagacctaacagatgattcgctaaaaggg
actccgaaaagagttgcgaaaatgtttgttaaagaaatatttggtggtttattaccagag
aacagaccaggtatgtcgacttttgaaaataaatataattacaaccaaatgttggtagaa
aaagatattgtagtctactctacctgtgaacatcatttcttgcccattgtcggtagagca
cacgtggcgtatatctcaaaagggagggtgattgggttgtcgaagatgaaccgtattgta
gattattttgccaaaagaccacaggtacaagaacgtctcacaatgcaagtagtaaaagca
ttgcaagacgctttagggaccgaagatgtagcatgtgttatcgatgctaaacacctttgt
gtaaactctagaggaattcgagatatcgaatcgagcaccgtgacagcagaatatggggga
caatttaaaaaagacgaaaacttaagaaaagagtttttaagctatttacgcttgaataca
acatttaatgtataa

DBGET integrated database retrieval system