KEGG   Weeksella virosa: Weevi_1277Help
Entry
Weevi_1277        CDS       T01441                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
wvi  Weeksella virosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:wvi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355906..1356649
Genome map
AA seq 247 aa AA seqDB search
MRVKSILVSQPKPQNESSPYYELEKNNKIKIDFRPFIQVEGVDAKDVRHQKIDFNRITAV
IFTSRNAIDHFFRLAEDLRYTVPDTMKYFCESEAIAFYLQKYIVYRKRKVFTGGKTFADL
VPLLKKHKDEKFLLPCSDVMKDEIPNTLNNLKIDWQKGILFRTVSSNLSDLEDVKYDILV
FFTPSGIKSLFDNFPDFKQENTRIAAFGKSTVDMAKELGLRIDIEVPTKETPSMTMALEK
YVKEVNK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgagttaaatcaatactagtttcacaaccaaaacctcaaaacgaatcttctccttat
tatgaattggagaagaacaacaaaatcaagatcgattttagaccttttattcaagtagaa
ggcgtagacgcaaaagatgtccgtcatcaaaagattgattttaatcgaattacagccgta
attttcacaagccgtaatgcaattgatcattttttccgtttggcagaagatttgcgttat
accgtacccgatacaatgaaatatttttgcgagtcagaagctattgccttttatttacaa
aaatatatcgtttacagaaaacgaaaagttttcacaggaggaaaaacatttgccgatttg
gtacctttgttgaaaaaacataaagacgaaaagtttttattgccatgctcagatgtgatg
aaagatgaaattccgaacaccttaaataatctgaaaatagattggcaaaaaggaatttta
ttccgaaccgtatccagcaacttatcagatttagaagatgtgaaatacgatattcttgtg
tttttcaccccttctggaataaaatctttattcgataattttccagattttaaacaagaa
aacacacgaattgctgcatttggtaaatcgacggtagatatggcaaaagaattaggctta
cgaatcgatatcgaagtcccaacaaaagaaacaccctccatgacaatggctctagaaaaa
tatgtgaaagaagtaaataagtaa

DBGET integrated database retrieval system