KEGG   Weeksella virosa: Weevi_1465Help
Entry
Weevi_1465        CDS       T01441                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
wvi  Weeksella virosa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Weevi_1465
Enzymes [BR:wvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Weevi_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1551051..1551464
Genome map
AA seq 137 aa AA seqDB search
MLYNHVVLLLGTNVGDKKKNIENAHVALYSVGLLIENHTIVLENQPVEFTSENLFFNQII
EAKTSLSPIELLKKIKKIEQDMGRKYAKPLDGEIYTDRLIDIDILYYNRINYVSKDLVIP
HPRAFTRKFVLDLLSML
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacaatcatgttgttttgttacttggcaccaatgtcggggacaagaaaaagaat
atagaaaatgctcatgttgcattgtatagtgttggtttgcttattgagaatcatactatt
gtgttagaaaatcagccagtagagtttacttcagaaaacttgttttttaatcagattatc
gaggcaaaaacgtctttatctcctatcgaattgttgaaaaaaataaaaaaaatagaacaa
gatatgggacggaaatatgccaagcctttggatggtgaaatatatactgatcgtttgata
gatattgatatattgtattataatcgaatcaattatgtatcaaaagaccttgtaattcca
catccaagagcatttactagaaaatttgtactagatttattatccatgttatag

DBGET integrated database retrieval system