KEGG   Weeksella virosa: Weevi_1470Help
Entry
Weevi_1470        CDS       T01441                                 

Definition
acetate/CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
wvi  Weeksella virosa
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Weevi_1470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Weevi_1470
   00620 Pyruvate metabolism
    Weevi_1470
   00640 Propanoate metabolism
    Weevi_1470
  Energy metabolism
   00680 Methane metabolism
    Weevi_1470
Enzymes [BR:wvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Weevi_1470
Lipid biosynthesis proteins [BR:wvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Weevi_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1557166..1559085
Genome map
AA seq 639 aa AA seqDB search
MNNIKDVRIKTYMDYKKAYQESVQKPDFFWDRIASKFYWHQKWSKTFEYDFDKAEFKWFL
DGKLNITENLLDQQLVTNGNKTAIIWEPNNPLEETRIITYKQLHYQVCKFANVLKNNGVQ
KGDRVCIYMPMIPELAIAMLACARIGAVHSVIFAGFSSSAIASRINDAQCKVLITANEVF
RGTKSVNLKAICDEALKDTPSIQSVIVYRRAIEPTVMVGGRDKFWIDEMHKVDAECSAEI
MDAEDPLFILYTSGSTGKPKGMVHTCGGYMVEVAYSFDNIFQMDNQDIFWCTADIGWITG
HSYIVYGPLLCGATTVMFEGIPSYPDYGRFWEIVEKLKVTHFYTAPTAIRSLAKQDISYV
NKYDLSSIKVLGSVGEPINEEAWHWFNDHIGKGNAPIVDTWWQTETGSILISPLAGITPT
RPTFATLPLPGVQPVLIDENGNVLDDEKAEKAEGRLAIKFPWPSIARTVYGDHQRYKETY
FSTFPGYYFTGDGAYRDAMGNYRITGRVDDVVIVSGHNLGTAPIENAINEHEKIAESAVV
GYPHDVKGNALYAYVILHDKQKGTEELEIEIKELVSKTIGPIAKPDKIQFVSDLPKTRSG
KIMRRILRKIASNEVNDFGDTSTLVDPTIIESILKDAQN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaataatataaaagatgtccgtatcaaaacgtatatggattataaaaaggcttatcaa
gaaagtgtacaaaaaccagattttttttgggatcgaattgcttctaaattttactggcat
cagaaatggtcaaaaacattcgaatatgattttgataaagccgaattcaaatggttttta
gacgggaaacttaatattaccgaaaatctattagaccaacaactggtcaccaacggaaac
aaaactgccatcatttgggaaccaaataatccattagaagaaaccagaatcataacctat
aaacaattgcattaccaagtatgtaagtttgctaacgtgctgaaaaataatggtgtgcaa
aaaggtgatcgtgtatgtatttatatgccaatgattccagaattagccattgcaatgctc
gcctgcgcaagaattggtgcagtacactctgtaatttttgctggcttttcgagttcggca
atcgcaagcagaataaacgatgcacaatgcaaagtattgattactgccaatgaagtcttt
cgaggaacgaaatcggtaaatctaaaagctatttgcgacgaggcactgaaagatacaccc
tcaatacaatctgttattgtgtaccgtcgtgcaatcgagccaacagttatggtaggcgga
cgtgataaattttggatagatgaaatgcataaagtagacgccgaatgttcggcagaaatt
atggatgccgaggaccctttatttattttatacacgtcgggttctacaggaaagccaaaa
ggcatggtacacacatgcggcggttatatggtcgaagttgcatatagtttcgataatatt
tttcagatggataatcaggatattttctggtgtacagccgatatcggttggataactggc
catagttatattgtatatggtccgcttttgtgtggagcaacaaccgtaatgttcgaggga
atcccgagttatccagattatggacgattttgggaaattgtagaaaaattaaaagtaacc
catttctatacagcaccaacagcaattcgttccttagcaaaacaagatatttcgtatgtc
aacaagtacgatttatcttctatcaaagtactaggttctgtaggagagcccattaacgaa
gaagcttggcactggttcaatgatcatatcgggaaagggaacgcacccatagtagatact
tggtggcaaaccgaaacaggttctatcctgatttctcctttagcagggataacccccact
cgccctacttttgcaactttaccattacccggtgttcaacctgttttgattgatgaaaat
ggaaatgttctagatgatgaaaaagcagaaaaagccgaaggtcgtttggcaataaaattc
ccttggccatccattgcaagaaccgtatatggcgatcatcaacgatacaaagaaacttat
ttctctacctttcctggatactatttcacgggagatggcgcttaccgcgacgcaatggga
aattaccgaatcaccggtcgagtagacgatgtagtgatagtctctggacataatttaggt
acagcaccgatagaaaatgcaatcaatgaacacgaaaaaattgccgaaagtgctgtggta
ggatatccgcacgatgtgaaagggaatgctctgtatgcttacgtcattttacatgataaa
caaaaaggaactgaagaactggaaatagaaatcaaagaattggtatccaaaacaataggt
ccgattgccaaaccagataaaatacaatttgtttcagacttgcctaaaacaagaagtggc
aaaatcatgcgaagaatcctacggaaaattgcatccaacgaagtcaatgactttggtgat
acttcgacacttgtagatcctacgattatcgaaagtatattaaaagatgctcaaaactaa

DBGET integrated database retrieval system