KEGG   Weeksella virosa: Weevi_1470Help
Entry
Weevi_1470        CDS       T01441                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
wvi  Weeksella virosa
Pathway
wvi00010  Glycolysis / Gluconeogenesis
wvi00620  Pyruvate metabolism
wvi00640  Propanoate metabolism
wvi00680  Methane metabolism
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
wvi01120  Microbial metabolism in diverse environments
wvi01130  Biosynthesis of antibiotics
wvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Weevi_1470
   00620 Pyruvate metabolism
    Weevi_1470
   00640 Propanoate metabolism
    Weevi_1470
  Energy metabolism
   00680 Methane metabolism
    Weevi_1470
Enzymes [BR:wvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Weevi_1470
Lipid biosynthesis proteins [BR:wvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Weevi_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADX68171
UniProt: F0NYP0
Position
1557166..1559085
Genome map
AA seq 639 aa AA seqDB search
MNNIKDVRIKTYMDYKKAYQESVQKPDFFWDRIASKFYWHQKWSKTFEYDFDKAEFKWFL
DGKLNITENLLDQQLVTNGNKTAIIWEPNNPLEETRIITYKQLHYQVCKFANVLKNNGVQ
KGDRVCIYMPMIPELAIAMLACARIGAVHSVIFAGFSSSAIASRINDAQCKVLITANEVF
RGTKSVNLKAICDEALKDTPSIQSVIVYRRAIEPTVMVGGRDKFWIDEMHKVDAECSAEI
MDAEDPLFILYTSGSTGKPKGMVHTCGGYMVEVAYSFDNIFQMDNQDIFWCTADIGWITG
HSYIVYGPLLCGATTVMFEGIPSYPDYGRFWEIVEKLKVTHFYTAPTAIRSLAKQDISYV
NKYDLSSIKVLGSVGEPINEEAWHWFNDHIGKGNAPIVDTWWQTETGSILISPLAGITPT
RPTFATLPLPGVQPVLIDENGNVLDDEKAEKAEGRLAIKFPWPSIARTVYGDHQRYKETY
FSTFPGYYFTGDGAYRDAMGNYRITGRVDDVVIVSGHNLGTAPIENAINEHEKIAESAVV
GYPHDVKGNALYAYVILHDKQKGTEELEIEIKELVSKTIGPIAKPDKIQFVSDLPKTRSG
KIMRRILRKIASNEVNDFGDTSTLVDPTIIESILKDAQN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaataatataaaagatgtccgtatcaaaacgtatatggattataaaaaggcttatcaa
gaaagtgtacaaaaaccagattttttttgggatcgaattgcttctaaattttactggcat
cagaaatggtcaaaaacattcgaatatgattttgataaagccgaattcaaatggttttta
gacgggaaacttaatattaccgaaaatctattagaccaacaactggtcaccaacggaaac
aaaactgccatcatttgggaaccaaataatccattagaagaaaccagaatcataacctat
aaacaattgcattaccaagtatgtaagtttgctaacgtgctgaaaaataatggtgtgcaa
aaaggtgatcgtgtatgtatttatatgccaatgattccagaattagccattgcaatgctc
gcctgcgcaagaattggtgcagtacactctgtaatttttgctggcttttcgagttcggca
atcgcaagcagaataaacgatgcacaatgcaaagtattgattactgccaatgaagtcttt
cgaggaacgaaatcggtaaatctaaaagctatttgcgacgaggcactgaaagatacaccc
tcaatacaatctgttattgtgtaccgtcgtgcaatcgagccaacagttatggtaggcgga
cgtgataaattttggatagatgaaatgcataaagtagacgccgaatgttcggcagaaatt
atggatgccgaggaccctttatttattttatacacgtcgggttctacaggaaagccaaaa
ggcatggtacacacatgcggcggttatatggtcgaagttgcatatagtttcgataatatt
tttcagatggataatcaggatattttctggtgtacagccgatatcggttggataactggc
catagttatattgtatatggtccgcttttgtgtggagcaacaaccgtaatgttcgaggga
atcccgagttatccagattatggacgattttgggaaattgtagaaaaattaaaagtaacc
catttctatacagcaccaacagcaattcgttccttagcaaaacaagatatttcgtatgtc
aacaagtacgatttatcttctatcaaagtactaggttctgtaggagagcccattaacgaa
gaagcttggcactggttcaatgatcatatcgggaaagggaacgcacccatagtagatact
tggtggcaaaccgaaacaggttctatcctgatttctcctttagcagggataacccccact
cgccctacttttgcaactttaccattacccggtgttcaacctgttttgattgatgaaaat
ggaaatgttctagatgatgaaaaagcagaaaaagccgaaggtcgtttggcaataaaattc
ccttggccatccattgcaagaaccgtatatggcgatcatcaacgatacaaagaaacttat
ttctctacctttcctggatactatttcacgggagatggcgcttaccgcgacgcaatggga
aattaccgaatcaccggtcgagtagacgatgtagtgatagtctctggacataatttaggt
acagcaccgatagaaaatgcaatcaatgaacacgaaaaaattgccgaaagtgctgtggta
ggatatccgcacgatgtgaaagggaatgctctgtatgcttacgtcattttacatgataaa
caaaaaggaactgaagaactggaaatagaaatcaaagaattggtatccaaaacaataggt
ccgattgccaaaccagataaaatacaatttgtttcagacttgcctaaaacaagaagtggc
aaaatcatgcgaagaatcctacggaaaattgcatccaacgaagtcaatgactttggtgat
acttcgacacttgtagatcctacgattatcgaaagtatattaaaagatgctcaaaactaa

DBGET integrated database retrieval system