KEGG   Weeksella virosa: Weevi_1531Help
Entry
Weevi_1531        CDS       T01441                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
wvi  Weeksella virosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:wvi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:wvi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:wvi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:wvi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:wvi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:wvi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:wvi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1622270..1623241)
Genome map
AA seq 323 aa AA seqDB search
MKRVGVLTSGGDSPGMNAAIRAVVRSCRYYNLESVGILQGYEGLIQNDMLTLGPRSVKNI
INQGGTILKTARSEEFRTIEGRKKAYQNIQKNNIDGLIVIGGDGSFKGANIFHQEFNLPF
IGIPGTIDNDIFGTDYTIGYDTALNTVVEAVDKLRDTATSHDRVFFVEVMGRDAGFIALN
SGIASGAQNILIPEKKDHINELIQSLEQSAKSGKKSSIVVVAEGEELGNVYELAKQVKAK
HPDYDIRVTVLGHIQRGGNPSCQDRVLASRLGIAAVEALMKGKTNVMTGLRSNKIVYTPI
EEAIQKHHSIDNELLKVAKILAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagttggtgttttaacttctggtggtgattctcctgggatgaatgctgcgata
cgagcagttgtcagatcttgcagatattacaacttagaatcagttgggattttacaagga
tatgaaggcttgatacaaaacgatatgctaacattgggacctcgatctgtaaaaaatatc
attaaccaagggggaaccatcttaaaaacagccagatctgaagagttcagaacgatagaa
ggtcgaaagaaagcgtatcaaaatattcaaaaaaataatattgatggtttaatagttata
ggtggcgatggctcttttaagggcgctaatatttttcatcaagaattcaatctacctttt
attggtataccgggaacgatagataatgatatttttggaacagattatacgattggttat
gatactgctcttaatactgtagtagaagcagtagacaaacttcgtgatacggcaacctca
cacgatcgtgttttttttgtagaagttatgggtcgcgatgcaggtttcattgctctaaat
agtggcattgcttctggcgcacaaaacattttaatcccagaaaaaaaagaccacatcaat
gaattgattcaatcattagaacaatctgcaaaatcgggcaaaaaatcaagcattgtcgtg
gtcgccgaaggtgaagagttggggaacgtttacgagttggctaagcaagtgaaagccaaa
caccccgattatgatatacgcgttacggttcttggtcacatacaacgcggcggtaaccca
agctgccaagatcgtgtattagcaagtcgtttagggattgcggctgtagaagcgttaatg
aagggcaaaaccaatgtcatgacggggctacgctcgaacaaaattgtttatactccgatt
gaggaagctatccaaaaacatcattctatcgataatgaattacttaaggttgcaaaaata
ttagcgatatag

DBGET integrated database retrieval system