KEGG   Weeksella virosa: Weevi_1531Help
Entry
Weevi_1531        CDS       T01441                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
wvi  Weeksella virosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Weevi_1531
   01230 Biosynthesis of amino acids
    Weevi_1531
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Weevi_1531
   00030 Pentose phosphate pathway
    Weevi_1531
   00051 Fructose and mannose metabolism
    Weevi_1531
   00052 Galactose metabolism
    Weevi_1531
  Energy metabolism
   00680 Methane metabolism
    Weevi_1531
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Weevi_1531
Enzymes [BR:wvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Weevi_1531
Protein phosphatases and associated proteins [BR:wvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Weevi_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1622270..1623241)
Genome map
AA seq 323 aa AA seqDB search
MKRVGVLTSGGDSPGMNAAIRAVVRSCRYYNLESVGILQGYEGLIQNDMLTLGPRSVKNI
INQGGTILKTARSEEFRTIEGRKKAYQNIQKNNIDGLIVIGGDGSFKGANIFHQEFNLPF
IGIPGTIDNDIFGTDYTIGYDTALNTVVEAVDKLRDTATSHDRVFFVEVMGRDAGFIALN
SGIASGAQNILIPEKKDHINELIQSLEQSAKSGKKSSIVVVAEGEELGNVYELAKQVKAK
HPDYDIRVTVLGHIQRGGNPSCQDRVLASRLGIAAVEALMKGKTNVMTGLRSNKIVYTPI
EEAIQKHHSIDNELLKVAKILAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagttggtgttttaacttctggtggtgattctcctgggatgaatgctgcgata
cgagcagttgtcagatcttgcagatattacaacttagaatcagttgggattttacaagga
tatgaaggcttgatacaaaacgatatgctaacattgggacctcgatctgtaaaaaatatc
attaaccaagggggaaccatcttaaaaacagccagatctgaagagttcagaacgatagaa
ggtcgaaagaaagcgtatcaaaatattcaaaaaaataatattgatggtttaatagttata
ggtggcgatggctcttttaagggcgctaatatttttcatcaagaattcaatctacctttt
attggtataccgggaacgatagataatgatatttttggaacagattatacgattggttat
gatactgctcttaatactgtagtagaagcagtagacaaacttcgtgatacggcaacctca
cacgatcgtgttttttttgtagaagttatgggtcgcgatgcaggtttcattgctctaaat
agtggcattgcttctggcgcacaaaacattttaatcccagaaaaaaaagaccacatcaat
gaattgattcaatcattagaacaatctgcaaaatcgggcaaaaaatcaagcattgtcgtg
gtcgccgaaggtgaagagttggggaacgtttacgagttggctaagcaagtgaaagccaaa
caccccgattatgatatacgcgttacggttcttggtcacatacaacgcggcggtaaccca
agctgccaagatcgtgtattagcaagtcgtttagggattgcggctgtagaagcgttaatg
aagggcaaaaccaatgtcatgacggggctacgctcgaacaaaattgtttatactccgatt
gaggaagctatccaaaaacatcattctatcgataatgaattacttaaggttgcaaaaata
ttagcgatatag

DBGET integrated database retrieval system