KEGG   Weeksella virosa: Weevi_1634Help
Entry
Weevi_1634        CDS       T01441                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
wvi  Weeksella virosa
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:wvi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:wvi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1734448..1735203
Genome map
AA seq 251 aa AA seqDB search
MIWVLVLFIFHWYASLFFQTFFHHRYAAHAMFQMSPFMEKVFHVLSFIFQGSSYLSPYAY
GVMHRMHHAYADTEKDPHSPLFDKDIFNMMWRTRLVYNEIDRNEVEVQQKFKKGVPAWRS
FDKIAENNWVRASWAIIYILIYLAIDAPLWTFFVFIPLHILMSPVHGVVVNWFSHKYGYR
NFEVNDTSTNFLAKDFLMWGECLHNNHHKFGGRPNFAVKKGEIDPMFPIIKLMAKANIIQ
FKPGRLDTEYM
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatttgggttcttgttttgtttatctttcattggtatgcatccttgttttttcagact
ttttttcatcatcgttatgctgcacatgctatgtttcagatgagtccttttatggagaaa
gtttttcatgtgttgtcttttatctttcagggttcatcttatcttagtccctatgcgtat
ggtgtaatgcatcgcatgcatcatgcctatgcagatactgaaaaagatccacattcgccc
cttttcgataaagatatttttaatatgatgtggagaacacgattggtgtacaatgaaatc
gatcgcaacgaagtagaggtacaacaaaaatttaagaaaggtgttcccgcatggcgttcg
ttcgacaagatagctgagaataattgggtaagggcatcttgggcgattatttatattttg
atttacctggcaatagatgctcctttgtggacatttttcgtgttcattcctttgcatatt
ttgatgagtccagtgcatggagtagtggtgaattggttttctcataaatacggttatcga
aatttcgaggtaaatgatacgtcgaccaatttcttggcgaaagattttcttatgtggggt
gaatgtttacataataatcaccataaatttggcggaagaccaaactttgctgtgaaaaaa
ggagagatcgacccgatgtttccgattataaaactaatggcaaaagccaatatcatacaa
ttcaaaccaggtcgtttagatacggaatatatgtaa

DBGET integrated database retrieval system