KEGG   Weeksella virosa: Weevi_2091Help
Entry
Weevi_2091        CDS       T01441                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
wvi  Weeksella virosa
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2254266..2255843
Genome map
AA seq 525 aa AA seqDB search
MNRKSFIRKTSLGLGGLFLYKPMSLFSKTKPKKEPIEKPIIIIGSGYGGAVAALRLCEAG
KKVCLLEMGLNWEKSGEKFSPMTHPGKSAAWLRKKTIAPFFNIFPLKPFTGTLDRLDYKN
IKIWVGRGVGGGSLVNGGMAVLPKKNYFKEIFPTLDVDLFYNKYFPLAQQELKVNVADEE
FLQSCSYYKFNKVGEKEAQKAGYKTIRVPNVYNFKYMEAEYENKVPRSALAGEVIYGNNH
GKYSLDKTYLKKADATGNLEILDLHQVKSIALNSDHSYTLSVDQINTSGEIVQVKEMRCQ
KLILAAGTMGSLELLLRSQAKNQLPLDEHIGKMWGNNGNFMTGRNWVKAFSGGNGYLHST
IPVGGIDNWDDPKYPFFAEIAPLPMGMNVATSLYLIINKLDKYGEVTYHPTEDKLDLKWD
LSHTKKMKENARHFIKKMNRTNGGTRAHFLFHNGFGHDICYHPLGGIVLEKATNPYGKLN
LHKNLFVLDGSLIPGSIGVNPFLTITALVEYCIEHLLQSKEFETV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaaaaagtttcatcagaaaaacttcattaggtttgggtggattatttttatat
aagcctatgtcattatttagtaaaacaaaaccaaaaaaagaaccgatagaaaaaccaatt
attataataggatctggctatggaggtgccgttgctgccttgcgactttgcgaagctggg
aaaaaagtctgcctattagaaatgggactcaactgggaaaaatcgggtgaaaaattctca
cctatgacacatcctggtaaaagtgctgcatggctacggaaaaaaaccattgcaccattt
ttcaatatatttccactgaaaccattcacaggtacactcgatcgattggactataaaaac
atcaaaatttgggtaggacgtggtgtaggcggtggatctctagtaaatggcggaatggct
gtattaccgaaaaaaaactatttcaaagaaatatttccaactctagacgttgatcttttt
tacaacaagtattttccattagcacaacaagaactaaaggtcaatgtggcagatgaagaa
ttcttgcaatcctgctcatattataaatttaataaagtaggtgaaaaagaagctcagaaa
gctggttacaaaaccatacgtgtaccaaatgtgtacaattttaagtatatggaggcagag
tatgaaaacaaagtgcctcgttctgctttggcaggagaagtgatttacgggaacaatcat
ggtaaatattcattagataaaacttatctaaaaaaagcagatgctaccggaaatctagag
attttggatttacatcaagtaaagagtattgctttgaattctgatcattcgtatacactt
tcggtagaccaaatcaacacttctggtgaaattgtacaggtgaaagaaatgcgttgtcag
aaattaatcttagcagcaggcaccatggggagtttagaattgttactacgctctcaggcc
aaaaatcaacttccgttagatgaacatattggtaaaatgtggggcaataatggaaatttc
atgactggcagaaattgggtaaaagcattttctggtggcaatggctatctgcactccact
attcctgtgggcggaatagacaactgggacgaccctaaatatccattctttgccgaaatt
gcacccttaccaatggggatgaacgtagctacaagcttatatctaattattaataaacta
gacaaatatggcgaagtaacttatcatcctaccgaagataaattagacttgaaatgggat
ctttcacacacaaagaaaatgaaggaaaacgctcggcatttcatcaagaaaatgaatcgt
accaatggcggtacacgtgctcactttttgtttcataatggttttggtcacgatatttgt
tatcatccattgggtggtattgttctcgaaaaggcaaccaacccatacggaaaacttaat
ttacataagaatctcttcgttttagatggttctctgattccggggagcatcggtgtaaat
ccttttttaacgattactgctcttgtcgaatattgtatagaacatttattacaatcaaaa
gagtttgaaacggtataa

DBGET integrated database retrieval system