KEGG   Weeksella virosa: Weevi_2101Help
Entry
Weevi_2101        CDS       T01441                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
wvi  Weeksella virosa
Pathway
wvi00220  Arginine biosynthesis
wvi00250  Alanine, aspartate and glutamate metabolism
wvi00471  D-Glutamine and D-glutamate metabolism
wvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Weevi_2101
   00220 Arginine biosynthesis
    Weevi_2101
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Weevi_2101
Enzymes [BR:wvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Weevi_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADX68775
UniProt: F0P247
Position
2265841..2266836
Genome map
AA seq 331 aa AA seqDB search
MYKTISFLSIAIFYILSTPSTIVCGQNKIIDKKVMLHLVNKHKLAFTQGKVADYIPELGK
ANPKAVAFSITNENGETWSVGDNKQKFTIQSISKLIALMLAVEENGEEKVFTQMGYYGTH
HPFNYFANLDHNGRPLNPMMNAGAIYTTSLIAGDADEPYQKILARIRYITNNPKIDINPT
IYESEKATGYRNRGMFYLMKNYGMIEKEEEVLNNYFRQCSIEIDVEDLSKIAYFIANQGT
RYDGDKTHYNKELMQLIQAQMLTAGMYEFSGEYARTIALPSKSGVGGGIIATVPNKIGIA
VYNPSLDEHGNSLVGYLILKDFVQEYSLGIF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaacgatatcttttctcagtattgctatcttttatattctgtctacaccatcg
acgattgtttgcggacagaacaaaataatcgataaaaaagtaatgctgcatttagtcaat
aaacataaactcgcttttacgcaaggcaaagtagcagattatattccagaattaggcaaa
gccaacccaaaagctgttgcattttctatcacaaacgaaaacggtgaaacatggagtgtt
ggtgataataaacagaaatttacaatccaaagtatttctaaattaattgctttgatgttg
gcagtagaagaaaatggcgaagaaaaggtttttacacaaatgggctattatgggacccat
catcctttcaactattttgccaatttagaccacaacggtcgtccactcaatccgatgatg
aatgcaggggccatctacacaacctctctgatagcaggagacgcagacgaaccttatcag
aaaatattggctagaattcgatacattaccaataatccgaaaatagatattaatccgact
atttacgaatctgaaaaagctactggataccgaaatcgtggtatgttttatttaatgaaa
aattatggtatgatcgaaaaagaagaagaagtactgaacaattatttccgtcaatgttcg
atagaaattgatgtggaagatttatcaaaaatagcttatttcattgccaatcaaggaacg
agatacgacggagataaaacacactacaacaaagaactcatgcaattgatacaagcacaa
atgctcacggctggtatgtacgagtttagcggcgaatatgctcgcacgattgctttgcca
agtaaatcgggggttggtggcggaattattgctacggttcccaacaaaataggaattgca
gtatacaacccttctctagatgagcacggcaattcgctggtaggttatttaattctaaag
gattttgttcaggaatattcgttaggaattttttaa

DBGET integrated database retrieval system