KEGG   Candidate division WWE3 bacterium RAAC2_WWE3_1: P147_WWE3C01G0369Help
Entry
P147_WWE3C01G0369 CDS       T02947                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
wwe  Candidate division WWE3 bacterium RAAC2_WWE3_1
Brite
Enzymes [BR:wwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     P147_WWE3C01G0369
Transfer RNA biogenesis [BR:wwe03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    P147_WWE3C01G0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(354977..356698)
Genome map
AA seq 573 aa AA seqDB search
MQINKTDSSKMIPMIRDISKAADEKEVLKVLFSNSRGLDDTYSKTTLLEEYKRLKGSGKL
VLTGKEEDRFLDNIKTKKIRTMSGVTPITVLTKPYPCPGKCIFCPSDVRMPKSYLSSEPG
AQRAHDNKFDPYYQTYNRLVAYEKTGHPVSKIELIVLGGTWTSYPEAYQLWFIKRCFDAL
NNFKPGTGSSYLTVKTELPYDEKKLVNLTGTYNAVVGLARNDKKLAGEDSTWEELFASHA
KNVAALCKCTGLVIETRPDEITKDEIVRMRRLGATKVQIGVQSLNDRVLKLNKRGHTAAR
TAEAFSLLREAGFKIHAHWMPNLYGSDPASDIRDFTKLFGDRKFRPDELKIYPCSLVEGT
ELMEHYGTGSWKPYTENELLHIFKTILPTVPRYCRVTRVVRDISGLDIVAGNKKTNFRQI
AEAELEKNRTKLKEIRSREIRDKKIDREDLIYKETTYLTAGTKEYFLEFVTKDDELAAFL
RLSLPERPTKVEEISGSAVIREIHVYGGSVVVGTGEEGRAQHVGLGKELIKKASDISRGA
GFKRLSVISSIGTRGYYEAIGFTQGALYQHLKL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaataaaaccgacagctctaagatgataccaatgataagggatatttccaaa
gccgctgatgaaaaggaagtgctaaaggtcctgtttagtaattcacgcggtctggacgat
acatactctaaaacgacccttttggaagaatataagagattgaaaggaagcgggaagctt
gttctgacgggtaaagaagaggaccggttcctggacaatataaaaacgaaaaagataaga
acaatgtccggggtaacacccataactgttcttactaagccgtatccgtgtcccggcaaa
tgtattttttgcccgagtgatgtacgtatgccgaaaagttatttatcgagtgagccggga
gcgcagagggcacacgataataaatttgacccgtattaccaaacgtataacagacttgtt
gcgtacgaaaaaacagggcatccggtcagcaaaatagagctaattgttttgggagggaca
tggacctcttaccccgaggcttatcagctgtggtttatcaaaagatgttttgacgcgttg
aacaacttcaagcccggaaccggttcttcctacttaactgttaagaccgagcttccgtat
gacgagaagaagcttgtgaacctaaccgggacgtacaatgctgttgtaggtctggccagg
aatgacaaaaaattggccggtgaagattccacgtgggaagaactgttcgcctcccacgca
aagaacgttgccgccttatgtaaatgtactggattagtgatcgagacacggcccgacgag
ataacaaaagacgagatagtgagaatgaggcgtctgggtgccacaaaagtacagataggt
gttcagagtctgaacgacagggtgctgaagctaaacaagagaggacataccgcggcaaga
accgcagaagccttttcgttattaagagaagccggtttcaagatacacgcgcattggatg
cctaacttgtacggttccgatccggcgtctgacataagggatttcacaaaattattcggt
gatagaaaattcagacctgacgagctgaagatctacccttgctctttggtagagggcact
gaacttatggagcactacggaacaggcagttggaaaccttacacggagaacgaacttttg
cacatttttaagaccattcttccgacggttccccgatattgccgcgttacccgtgttgtg
cgcgatatttcggggttggacattgtagccggaaacaaaaaaaccaatttcaggcaaata
gctgaggccgaactcgagaagaacaggacaaaattaaaggagatacgttccagggagatt
agagacaaaaagatcgacagggaagatctgatttataaagaaacgacttatctgactgcc
ggtactaaggaatatttcctggaattcgtgacgaaggatgatgagcttgccgcttttctc
agactttctttgcccgaaagacctacgaaggtagaggagatatcgggttctgcagtgata
agggaaatacatgtttacggagggagtgttgtggtaggcacgggagaagaaggcagggcc
cagcacgtaggtttgggaaaagaattaataaagaaagcctcagatatatcccgcggggca
ggttttaagaggctttcagtaatttcctcaataggaacgcgcggatactacgaggctatc
ggcttcacacagggagccttataccagcatttaaaactttag

DBGET integrated database retrieval system