KEGG   Candidate division WWE3 bacterium RAAC2_WWE3_1: P147_WWE3C01G0638Help
Entry
P147_WWE3C01G0638 CDS       T02947                                 

Definition
Formamidopyrimidine-DNA glycosylase Fapy-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
wwe  Candidate division WWE3 bacterium RAAC2_WWE3_1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:wwe00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    P147_WWE3C01G0638
Enzymes [BR:wwe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     P147_WWE3C01G0638
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     P147_WWE3C01G0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
627515..628342
Genome map
AA seq 275 aa AA seqDB search
MPELPETHTIAALLNKGLKGKTISKVQVFKDYRALPSTEVFIKAVTGKKIESVKRVAKNI
LVELSNGTHILFHLAMTGRLLLWNDLIGNERWVKVILHLDNGTKLTFSDMRMFGKAAILS
PKQTGELAARYGPEPLDENTTPQQLFENLKTKRTNIKNALLNQEIISGLGNIYVTDALFL
AGINPLIGTNEVTLETVTRLLDSIRSVLRESIKLGGSTLGDKMYVDPFGREGKYQEYFKI
YSREKCPVCGSKVSFIKISGRGTYFCPVCQPLNRQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacttcccgaaactcacacgattgccgccctgttgaataaaggtctcaaagga
aaaaccatttctaaagttcaggttttcaaggattacagagccttgccgtcaaccgaagtt
tttattaaagccgtgacaggcaaaaagattgaatcggtgaaaagagtggccaaaaacatc
ctcgtcgaactctcgaacggaacacacatactttttcacctcgcgatgaccggccggttg
ttgctgtggaacgaccttatcgggaatgaaaggtgggtgaaagtaatcctgcacctggac
aatgggactaagcttaccttcagcgacatgagaatgttcggaaaggccgcaatcctcagt
ccaaaacaaacgggggaacttgcggcgaggtatggtccggaacccctggatgaaaataca
accccacaacaattgtttgaaaatcttaaaaccaaaaggacaaatatcaaaaacgcgctt
cttaatcaagagataatatcgggattgggaaatatatatgtaacggacgcgctttttctc
gccggaatcaatccgcttatcggaacaaatgaggtcacgttagaaactgttacccgactg
cttgactcgataaggtcggttcttagagaaagcataaaattagggggctctaccctcggc
gataaaatgtacgttgacccgttcggaagggaaggaaaatatcaggagtattttaagata
tactccagagaaaaatgcccggtgtgcgggtcgaaagtaagtttcattaaaatatcggga
aggggcacatatttttgcccggtctgccaacccctaaataggcaatga

DBGET integrated database retrieval system