KEGG   Xanthomonas axonopodis pv. citri 306: XAC0029Help
Entry
XAC0029           CDS       T00084                                 

Gene name
egl
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xac00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32718..33770)
Genome map
AA seq 350 aa AA seqDB search
MKSLTTHTRRLRCRALSFLLLAAMPLAQAQSATGLKYAGVNLSGAEIKSSQKPGVLNIDY
RYPAADEYAYFAGKHMNTVRLPILWERLQPRAGGELDPAQLALIRQAVANAKAAKMYVIV
DVHNYAKYYGHTIGSTKVPISTFNDLWRRLAIAFKSDNAVIFGLMNEPYDIDPQAWATAA
QASIDTIRKTGATNLILVPGALWTGAHSWYSTVAGQSNAVAMASIRDPLNRYAIEAHQYL
DADSSGTSGGCVSATVGVERLRSFTEWLRLNKKRGFLAEFGTGNTVTCNLALNGMLGYME
SNSDVWMGWSWWAAGAWWSGAYPFNVQPDAQGRDKPQMSILSPRARRITD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccctcaccacgcatacgcgccggctgcgttgccgcgcgctgtctttcctattg
ctggccgccatgcccctcgcgcaggcgcaaagcgccaccggcctgaagtatgcaggcgtc
aatctttctggcgccgagatcaaatcctcgcaaaagcccggcgtgctcaacatcgactac
cgttatccggcggccgatgaatacgcctacttcgccggcaagcacatgaacaccgtgcgc
ctgccgatcctgtgggaacgtctgcagccaagggcggggggcgagctggacccggcccag
ctggcgttgatccggcaggcggtcgccaacgccaaggcggccaaaatgtacgtgatcgtg
gatgtgcacaactacgccaagtattacggccacaccatcggcagcacgaaagtgccgatc
agcaccttcaacgatctatggcgacggctggcgatcgccttcaagagcgacaacgccgtg
atcttcgggctgatgaatgagccttacgacatcgatccgcaagcgtgggcgacggccgcg
caggcgtccatcgacaccattcgtaaaaccggcgccaccaatctgattctggtaccgggt
gcgttgtggacaggcgcgcatagctggtactccacggtggccgggcaatccaatgcagtg
gcgatggcatccattcgcgacccgctcaatcgttatgccatcgaagcgcatcaatatttg
gatgccgattccagcggcaccagcggtggttgcgtcagcgccacggtcggggtcgaacgg
ctgcgcagcttcaccgagtggctgcgtctgaacaaaaaacgcgggtttctcgccgaattc
ggcaccggcaatacggtcacctgcaatctcgcgctcaacggcatgttgggctacatggaa
tccaacagcgatgtgtggatgggctggtcctggtgggcggcaggcgcatggtggagtggg
gcgtatccgttcaacgtgcaaccggatgcgcaagggcgcgacaagccgcagatgtcgata
ttgagcccacgtgcgcgccggattaccgattaa

DBGET integrated database retrieval system