KEGG   Xanthomonas citri pv. citri 306: XAC0030Help
Entry
XAC0030           CDS       T00084                                 

Gene name
egl
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XAC0030 (egl)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XAC0030 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34548..35621)
Genome map
AA seq 357 aa AA seqDB search
MFRTPPYFPRLRIAALALTLLAAGPLAQAKEPPGPRRETAGLKYVGVNLSGAEFNSRKKP
GTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKA
NKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISA
PDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLA
FEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALE
GMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYARRAGK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcactccaccgtactttccccgcctgcgcatcgccgcgctcgcgttgaccttg
ctcgccgccggtccgttggcccaggccaaggagccgcccggccccaggagggaaaccgcc
ggcctgaagtatgttggcgtcaatctgtccggtgccgagttcaactcgcgcaagaaaccc
ggcaccttgttcaaggactacacctatcctgccgcctcggacttcagctatttcgccggc
aagggcatgaatacgatccgattgccgttcctgtgggaacgcgtgcagcccgagctcaat
ggcccgctggaccaggcccaattggggctgatcaagaagtcgctcgaggcagccaaggcc
aacaagcaatacctgatcctggatctgcacaactatgccacgtacagcggcaagcgcatc
ggcaccagcgacgtgccggccggcgcgttggccgatctgtggcgccggctggcgctggag
ttcaaggacgacaaggcggtgatcttcgggctgatgaacgagcccaatggcatttccgcg
cccgactgggccaatgccgcgcaggggacgatcactgcgatccgcaagaccggcgcgaag
aatctgatcctggtgccgggcaccgcctacaccggcgcacacagctggcgcagcaccagc
tacggcgtctccaacgcaaaggcgctggaaatcctcaaggacccgggtaacaaccttgcc
ttcgaagcgcatcaatacctggataaggactacagcggcaccaagccggtatgcaccagc
gattcggtaggccaagaaaagctgcagggcttcacctcgtggctgcgcgagaacaagcag
aagggcttcctgggcgaattcgccacggccaacaatccggtctgcgacaaggcgctggaa
ggcatgctgacctacatggaaaagaacagcgacgtgtggctgggctggacctggtgggcg
gcgggcgcgtggtggaagccggactatcccttcaccgtgcaaccgggcaaggacggcagc
gacaagccgcagatggcgatcctgagcaagtacgcacgccgcgccggcaagtaa

DBGET integrated database retrieval system