KEGG   Xanthomonas citri pv. citri 306: XAC0059Help
Entry
XAC0059           CDS       T00084                                 

Gene name
asn
Definition
asparagine synthetase like protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XAC0059 (asn)
Enzymes [BR:xac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     XAC0059 (asn)
Peptidases [BR:xac01002]
 Cysteine Peptidases
  Family C44
   XAC0059 (asn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(72303..74228)
Genome map
AA seq 641 aa AA seqDB search
MSDFAGVWRLDGAPVAPGDIQRLGQALDARGIGPVRVWQDGPVAIVHRQHVFTPQDADEA
MPWVGASGAVLAADVRLAARQELASALQHPANVTLPDGVLLLEALQCWDTAALPRLHGCY
ALALYRPDRHRLLLARDPIGLRSLFVHRGPHLIAFATRLRALLALPQVPKDLDERALADK
LIMDRARPERTIYRAIDRVPMAHAVVLTPEATHCQRWWSPPEAGSLRLRNDAEVEAAAAE
VLDRAVADALRARGPVATCLTGGLDSGSITLSAARQQAPSPLLVLTRQPLPATAAATATH
YYDESPRARRLAASHPGIDWHLVGDDDADWGEHDPACWWREGAQPVRSPSNMAWFFPLYR
FLHARGSQVMLGGELGNAFFSYDGLLRLPQLARQRQWRVLAGQVGALAGSLGLSRRKTVQ
RYLLRPFAPVALLRLWHGLPAAVWEAQAALQPALAQSLGMQQSLDRSRYRLRLGGGHTSL
PTFREWMLGDAGPMDLVNTLRAVSGVDTRYPLADRRVIEFFGSLPLDQFLRDGVSRSLPR
RLLAARGAPPEIHANRAVGVQQGDWFARLNAQRDALHAQLSQARTSPLANRVVDLQRLQA
LLDHWPQDAAAAEARRFEYLQLLASGLQMAGFLAWHERGGA
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttcgccggcgtctggcggctggatggcgcgccagttgcgccgggcgacatc
cagcgtttgggccaggcgctggacgcgcgcgggataggcccggtgcgtgtctggcaggat
gggccggtcgcaatcgtgcatcgtcaacatgtctttaccccgcaggatgccgatgaggcg
atgccctgggtgggggcatccggcgcggtcctggcggccgacgtcaggctggccgcgcgc
caggaacttgcgtctgcgctgcagcaccccgccaacgtcaccctgcccgatggtgtgctg
ctgctggaggccttgcagtgctgggataccgcggcgctgccgcgcctgcacgggtgttat
gcactggcgctgtatcggccggaccggcatcgcctcttgctggcccgcgatccgattggc
ttgcgttcgctgttcgtgcatcgcggaccgcacctgatcgcattcgccactcgcctgcgg
gcgctactggcacttccgcaggtgccgaaagacctggacgagcgcgccctggccgacaaa
ctgatcatggaccgtgctcgaccggagcgcaccatctaccgcgcgatcgaccgggtacca
atggcgcatgcggtcgtgctgaccccggaggcgacacactgccagcgctggtggtcgccg
cccgaggccggatcgctgcgcttgcgcaacgatgccgaagtggaagctgcggcagccgag
gtactggaccgtgccgtggccgatgcgctgcgcgcacgcggaccggtggccacctgtctg
accggcggactggacagcggttcgatcacgctgtcggcagcgcggcaacaggcgccgtcg
ccgttgctggtgctcacgcgtcaaccgctgcctgcgactgccgctgccactgcgacccac
tactacgacgagtcgccgcgcgcgcggcggctggccgccagccatccaggcatcgactgg
cacctggtcggcgacgacgacgcggactggggcgaacacgatccggcatgctggtggcgc
gagggtgcgcagccggtccgttcgccctcgaacatggcctggttcttcccgctgtaccgg
ttcctgcacgcacgcgggagccaggtgatgctgggcggcgaactgggcaacgccttcttc
agctacgacggcctgttgcgtctgccgcagctggcgcgtcagcggcaatggcgtgtgctg
gccggacaggtcggtgcacttgccggcagcctcggcctgagtcggcgcaagaccgtgcag
cgctatctgctgcgccctttcgcgccggttgcgctgctgcgcctgtggcatggcctgcct
gccgcggtctgggaagcgcaggctgcattgcagccggcactggcgcagtcgcttgggatg
cagcagtcgctggatcggtccagataccggttgcgcctcggcggcggccacacgtccctg
ccgaccttccgcgagtggatgctgggcgatgccggtccgatggacctggtcaacacgctg
cgcgcggtgtccggggtcgacacgcgttatccgcttgcagaccgacgggtgatcgaattc
ttcggcagcctgccgttggatcaattcctgcgcgatggtgtcagccggtcgttgccacgc
cgcttgctggccgcacgcggcgcgccgccggagatccacgccaaccgtgcggtcggcgtg
caacaaggcgactggttcgcgcggttgaatgcgcagcgcgatgcgctgcacgcgcaactg
agccaagcgcgcacttcgccgctggccaatcgggtcgtggacctgcagcgcttgcaggcg
ctgctggaccactggccgcaggatgccgcagcggccgaagcgcgccgctttgagtacttg
cagctgctggcgtccggcttgcagatggcgggtttcctggcctggcacgagcgcggcggc
gcgtga

DBGET integrated database retrieval system