KEGG   Xanthomonas citri pv. citri 306: XAC0156Help
Entry
XAC0156           CDS       T00084                                 

Gene name
glgB1
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XAC0156 (glgB1)
Enzymes [BR:xac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XAC0156 (glgB1)
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XAC0156 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
192605..194779
Genome map
AA seq 724 aa AA seqDB search
MSNRWDSGVVRALAEARHGDAFAVLGAHPSDKGRLLRTYLPGADRVGAVLDDGQVVALDA
GPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAFGPQLSDFDLHLISEGHHLQLADAL
GANVVEVEGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQSGVWELFVPDVGPG
AHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHD
APMSIYEIHAGSWLREAGVDLDWDGLADRLIPYVADMGFTHVELMPVSEHPFGGSWGYQP
LGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEHADP
REGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRDYSRNAGEW
IPNIHGGRENYETIAFLRRLNEVVREHTPGAVMIAEESTAFPGVTAEVAHGGLGFHYKWN
MGWMHDTLHYAGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRMPGD
DWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDPRHRGVQTLVR
DLNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVINFTPVVQH
AYRIGVPQGGQWREVFNSDAGIYGGSNLGNGGSVTAEQQSMHGHAQSLPLLLPPLGAIVL
TPYG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatcgatgggattccggcgtggtacgcgccctggcagaggcgcgccacggcgac
gcgtttgcggtcttgggtgcgcacccgtccgacaaggggcgcttgttgcgcacctatcta
cccggcgccgaccgcgtcggtgcggtgctcgacgatgggcaggtggtggcgctggacgcc
ggcccggagccgggcctgtttgccggcgagttgccggcgcacggcgggtatcgcctgcgc
atcggctggcccggtggcgagcaggagaccgcagacccgtatgcgttcggcccgcagctc
agcgacttcgacctgcacctgatcagcgaaggccaccatctgcagctggccgacgcgctg
ggcgccaacgtggtcgaggtggagggcgtacgcggcacgcgctttgccgtctgggcaccg
aatgcctcgcgcgtggcggtggtgggcgacttcaacagctgggacgcgcgccgtcatccg
atgcggctgcggcatcagtccggcgtgtgggaattgttcgtgcccgacgtcggccccggc
gcgcattacaagtaccagctgcgtggtccgcacgggcacgagttgccggccaaggccgac
ccggtggcgcgccgcgcggagcttgcgccgggcactgcgtccatcgtggccgatcccacg
ccgcatcagtggagcgacgacggctggatggccacgcgtgcgcgtcgccaggcccacgac
gcgccgatgagcatctacgagatccacgccggctcgtggctccgcgaagcaggggttgac
ctggattgggatgggctggccgaccgcctgatcccgtacgtggccgacatgggcttcacc
catgtcgagttgatgccggtgagcgagcatccgttcggcggctcatggggttatcaacca
ttgggtctgttcgcgcccactgcgcgcttcggcacgcccgatggatttgcgcgctttgtc
gaccgctgccatcgcgaaggcatcggcgtgatcgtcgactgggtgccggcgcactttccc
accgatgcgcacgggctggcgcatttcgacggcaccgcgctgtacgagcatgccgacccg
cgcgaaggcttccaccgcgactggaatacgctgatctacaaccacggccgccgcgaggtg
tccgggttcctgatcgccagtgcgatggaatttctgcagcgctatcacgtggacggcctt
cgcgtggatgcggtggcctcgatgctgtaccgcgattacagccgcaacgccggcgagtgg
atacccaacatccacggcgggcgcgagaactacgagaccatcgcattcctgcgccggctc
aacgaggtggtgcgcgagcacaccccgggcgcggtaatgattgccgaagaatccactgcg
tttcccggtgtcaccgccgaggtggcgcacggcggcctgggctttcactacaagtggaac
atgggctggatgcacgacaccctgcattacgccgggttggacccgatctatcgccgctac
catcatggcgagctgactttcagcatggtctatgcgtattcggagcgcttcgtgctgccg
atctcgcacgacgaagtggtgcacggcaagggttcgttgctgggccgcatgccgggcgac
gattggcaacgcttcgccaacctgcgcgcgtacttgggtttcatgttcacccacccggga
cgcaagttgctgttcatgggctgcgaattcggccagccgaccgagtggaatcacgacgcc
ggcctgccgtggcatttgctcgacgaccctcgccatcgtggggtgcagacgctggtgcgc
gatttgaaccggctgtatgtccaatacccggcgctccacgcacacgacgacgatccgtcc
gggtttgcctgggtggtgggcgacgatgccggcaacagcgtggtggcgttcctgcgcaag
ggcaaacgcggcgacgcaccggtgctggtggtgatcaacttcaccccggtcgtgcaacac
gcatatcgcatcggtgtgccacaaggcggccagtggcgcgaggtgttcaatagcgacgcc
ggcatctacggcggcagcaacctgggcaatggcggcagcgtcaccgccgagcagcaatcc
atgcatgggcacgcgcaatcgctgccgctgctgttgccaccgctgggcgccatcgtgctg
acgccgtatggctga

DBGET integrated database retrieval system