KEGG   Xanthomonas axonopodis pv. citri 306: XAC0156Help
Entry
XAC0156           CDS       T00084                                 

Gene name
glgB1
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xac00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192596..194779
Genome map
AA seq 727 aa AA seqDB search
MTAVSNRWDSGVVRALAEARHGDAFAVLGAHPSDKGRLLRTYLPGADRVGAVLDDGQVVA
LDAGPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAFGPQLSDFDLHLISEGHHLQLA
DALGANVVEVEGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQSGVWELFVPDV
GPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQ
AHDAPMSIYEIHAGSWLREAGVDLDWDGLADRLIPYVADMGFTHVELMPVSEHPFGGSWG
YQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEH
ADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRDYSRNA
GEWIPNIHGGRENYETIAFLRRLNEVVREHTPGAVMIAEESTAFPGVTAEVAHGGLGFHY
KWNMGWMHDTLHYAGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRM
PGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDPRHRGVQT
LVRDLNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVINFTPV
VQHAYRIGVPQGGQWREVFNSDAGIYGGSNLGNGGSVTAEQQSMHGHAQSLPLLLPPLGA
IVLTPYG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagtgagcaatcgatgggattccggcgtggtacgcgccctggcagaggcgcgc
cacggcgacgcgtttgcggtcttgggtgcgcacccgtccgacaaggggcgcttgttgcgc
acctatctacccggcgccgaccgcgtcggtgcggtgctcgacgatgggcaggtggtggcg
ctggacgccggcccggagccgggcctgtttgccggcgagttgccggcgcacggcgggtat
cgcctgcgcatcggctggcccggtggcgagcaggagaccgcagacccgtatgcgttcggc
ccgcagctcagcgacttcgacctgcacctgatcagcgaaggccaccatctgcagctggcc
gacgcgctgggcgccaacgtggtcgaggtggagggcgtacgcggcacgcgctttgccgtc
tgggcaccgaatgcctcgcgcgtggcggtggtgggcgacttcaacagctgggacgcgcgc
cgtcatccgatgcggctgcggcatcagtccggcgtgtgggaattgttcgtgcccgacgtc
ggccccggcgcgcattacaagtaccagctgcgtggtccgcacgggcacgagttgccggcc
aaggccgacccggtggcgcgccgcgcggagcttgcgccgggcactgcgtccatcgtggcc
gatcccacgccgcatcagtggagcgacgacggctggatggccacgcgtgcgcgtcgccag
gcccacgacgcgccgatgagcatctacgagatccacgccggctcgtggctccgcgaagca
ggggttgacctggattgggatgggctggccgaccgcctgatcccgtacgtggccgacatg
ggcttcacccatgtcgagttgatgccggtgagcgagcatccgttcggcggctcatggggt
tatcaaccattgggtctgttcgcgcccactgcgcgcttcggcacgcccgatggatttgcg
cgctttgtcgaccgctgccatcgcgaaggcatcggcgtgatcgtcgactgggtgccggcg
cactttcccaccgatgcgcacgggctggcgcatttcgacggcaccgcgctgtacgagcat
gccgacccgcgcgaaggcttccaccgcgactggaatacgctgatctacaaccacggccgc
cgcgaggtgtccgggttcctgatcgccagtgcgatggaatttctgcagcgctatcacgtg
gacggccttcgcgtggatgcggtggcctcgatgctgtaccgcgattacagccgcaacgcc
ggcgagtggatacccaacatccacggcgggcgcgagaactacgagaccatcgcattcctg
cgccggctcaacgaggtggtgcgcgagcacaccccgggcgcggtaatgattgccgaagaa
tccactgcgtttcccggtgtcaccgccgaggtggcgcacggcggcctgggctttcactac
aagtggaacatgggctggatgcacgacaccctgcattacgccgggttggacccgatctat
cgccgctaccatcatggcgagctgactttcagcatggtctatgcgtattcggagcgcttc
gtgctgccgatctcgcacgacgaagtggtgcacggcaagggttcgttgctgggccgcatg
ccgggcgacgattggcaacgcttcgccaacctgcgcgcgtacttgggtttcatgttcacc
cacccgggacgcaagttgctgttcatgggctgcgaattcggccagccgaccgagtggaat
cacgacgccggcctgccgtggcatttgctcgacgaccctcgccatcgtggggtgcagacg
ctggtgcgcgatttgaaccggctgtatgtccaatacccggcgctccacgcacacgacgac
gatccgtccgggtttgcctgggtggtgggcgacgatgccggcaacagcgtggtggcgttc
ctgcgcaagggcaaacgcggcgacgcaccggtgctggtggtgatcaacttcaccccggtc
gtgcaacacgcatatcgcatcggtgtgccacaaggcggccagtggcgcgaggtgttcaat
agcgacgccggcatctacggcggcagcaacctgggcaatggcggcagcgtcaccgccgag
cagcaatccatgcatgggcacgcgcaatcgctgccgctgctgttgccaccgctgggcgcc
atcgtgctgacgccgtatggctga

DBGET integrated database retrieval system