KEGG   Xanthomonas citri pv. citri 306: XAC0256Help
Entry
XAC0256           CDS       T00084                                 

Gene name
mls
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC0256 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XAC0256 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    XAC0256 (mls)
Enzymes [BR:xac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XAC0256 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304727..306343
Genome map
AA seq 538 aa AA seqDB search
MAATAFAPRPNDHATPGIALTTQIAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRRQR
QAAFDAGQLPDFRTDTQAIRTGDWRVAPLPVALQDRRVEITGPTDPKMVINALNSGAKVF
MADFEDSTAPTWRNLLAGQRTLVAAVRGDLSFDAPNGKHYALRPEAERAVLIVRPRGWHL
DEKHVLIDGQPLAGGLFDAALFAFHNGRTLLAKDRGPYLYLPKLQSMEEAALWDTALAHI
EAMLGLPHGQIKVTVLIETLPAVFEMDEILYALRERIVGLNCGRWDYIFSYLKTFRAHRD
RVLPERGQVTMTQPFLRAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARVRA
DKLREVSAGHDGTWVAHPALIPVAMKLFDEHMPTAHQQHVLRNDVQVTRDLLIAPSPGNV
TRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRAQLWQWLHHGQHLDDGTA
IDQHLLQATLRALPARLGTATALPGAARIDEAIALLEELSGADELADFLTVPAYRLID
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaccgcgtttgctccccgccccaacgaccacgccacgcccggcattgcgctg
accacccagatcgccggccaggcggagctgctgccggccgctgcgcttgccttgctggtc
tcgttgcaccgggcgatcgagcccggccgccaacagcgtctggcccagcggcgccagcgc
caggccgccttcgacgccggtcagctgccagacttccgtaccgacacccaggccatccgt
accggcgactggcgcgtggcccctctgccggtggcgctgcaggaccgtcgcgtcgaaatc
accggcccaaccgacccgaagatggtcatcaacgcgctgaactccggcgccaaggtgttc
atggccgacttcgaagattccaccgcgccgacctggcgcaacctgctggccggccagcgc
accctggttgcggcggtgcgcggcgatctcagcttcgatgcgcccaacggcaagcattac
gccctgcgcccggaggccgaacgtgcggtgctgatcgtgcgtccgcgtggttggcacctg
gacgaaaagcacgtgctgatcgacggccagccgctggccggcggcctgttcgatgcggcg
ttatttgccttccacaatggccgcacgttgctggccaaggaccgcggcccgtacctgtat
ctgcccaagctgcagagcatggaagaagccgcactgtgggacaccgcgctggcgcatatc
gaagcgatgctgggcctgccgcatgggcagatcaaggtcaccgtgctgatcgaaacgctg
ccggcggtgtttgagatggacgaaattctctacgcgctgcgcgagcgcatcgttgggctc
aattgcgggcgttgggactacattttttcctacctgaaaacctttcgtgcgcaccgcgac
cgcgtgctgcccgaacgcggccaggtcaccatgacccagccattcttgagggcgtattcg
gagctgttgatcaagacctgccaccgccgcggcgcgcatgcgatgggcggcatggccgcg
cagattccgatcaaccacgatgaagccgccaacgaacaggccatggcccgcgtgcgcgcc
gacaagctgcgcgaagtgagcgccggccacgatggcacctgggtggcgcatccggcgctg
attccggtggcgatgaaactgttcgacgaacacatgcccaccgcgcatcagcagcatgtg
ttgcgcaacgacgtgcaggtgacgcgcgacctgctgatcgcgccctcgccgggcaatgtc
acccgcgccggcttcgaaggcaatgtcgaagtatgcgtgcgctatctggcggcctggctg
gacggcaatggctgcgtgccgatccaccacctgatggaagacgccgccacggccgaaatc
agccgcgcgcagctgtggcaatggttgcaccacggtcagcacctggatgatggcacagcc
atcgatcaacacctgctgcaggcgaccctgcgcgcactgcccgcacggttgggaaccgcc
accgcgctgcccggcgctgcacggatcgatgaagcgatcgccttgctcgaagagttgagc
ggcgccgacgaactggcggacttccttactgtaccggcgtaccgcctgatcgactga

DBGET integrated database retrieval system