KEGG   Xanthomonas citri pv. citri 306: XAC0256Help
Entry
XAC0256           CDS       T00084                                 

Gene name
mls
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC0256 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XAC0256 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    XAC0256 (mls)
Enzymes [BR:xac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XAC0256 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304727..306343
Genome map
AA seq 538 aa AA seqDB search
MAATAFAPRPNDHATPGIALTTQIAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRRQR
QAAFDAGQLPDFRTDTQAIRTGDWRVAPLPVALQDRRVEITGPTDPKMVINALNSGAKVF
MADFEDSTAPTWRNLLAGQRTLVAAVRGDLSFDAPNGKHYALRPEAERAVLIVRPRGWHL
DEKHVLIDGQPLAGGLFDAALFAFHNGRTLLAKDRGPYLYLPKLQSMEEAALWDTALAHI
EAMLGLPHGQIKVTVLIETLPAVFEMDEILYALRERIVGLNCGRWDYIFSYLKTFRAHRD
RVLPERGQVTMTQPFLRAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARVRA
DKLREVSAGHDGTWVAHPALIPVAMKLFDEHMPTAHQQHVLRNDVQVTRDLLIAPSPGNV
TRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRAQLWQWLHHGQHLDDGTA
IDQHLLQATLRALPARLGTATALPGAARIDEAIALLEELSGADELADFLTVPAYRLID
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaccgcgtttgctccccgccccaacgaccacgccacgcccggcattgcgctg
accacccagatcgccggccaggcggagctgctgccggccgctgcgcttgccttgctggtc
tcgttgcaccgggcgatcgagcccggccgccaacagcgtctggcccagcggcgccagcgc
caggccgccttcgacgccggtcagctgccagacttccgtaccgacacccaggccatccgt
accggcgactggcgcgtggcccctctgccggtggcgctgcaggaccgtcgcgtcgaaatc
accggcccaaccgacccgaagatggtcatcaacgcgctgaactccggcgccaaggtgttc
atggccgacttcgaagattccaccgcgccgacctggcgcaacctgctggccggccagcgc
accctggttgcggcggtgcgcggcgatctcagcttcgatgcgcccaacggcaagcattac
gccctgcgcccggaggccgaacgtgcggtgctgatcgtgcgtccgcgtggttggcacctg
gacgaaaagcacgtgctgatcgacggccagccgctggccggcggcctgttcgatgcggcg
ttatttgccttccacaatggccgcacgttgctggccaaggaccgcggcccgtacctgtat
ctgcccaagctgcagagcatggaagaagccgcactgtgggacaccgcgctggcgcatatc
gaagcgatgctgggcctgccgcatgggcagatcaaggtcaccgtgctgatcgaaacgctg
ccggcggtgtttgagatggacgaaattctctacgcgctgcgcgagcgcatcgttgggctc
aattgcgggcgttgggactacattttttcctacctgaaaacctttcgtgcgcaccgcgac
cgcgtgctgcccgaacgcggccaggtcaccatgacccagccattcttgagggcgtattcg
gagctgttgatcaagacctgccaccgccgcggcgcgcatgcgatgggcggcatggccgcg
cagattccgatcaaccacgatgaagccgccaacgaacaggccatggcccgcgtgcgcgcc
gacaagctgcgcgaagtgagcgccggccacgatggcacctgggtggcgcatccggcgctg
attccggtggcgatgaaactgttcgacgaacacatgcccaccgcgcatcagcagcatgtg
ttgcgcaacgacgtgcaggtgacgcgcgacctgctgatcgcgccctcgccgggcaatgtc
acccgcgccggcttcgaaggcaatgtcgaagtatgcgtgcgctatctggcggcctggctg
gacggcaatggctgcgtgccgatccaccacctgatggaagacgccgccacggccgaaatc
agccgcgcgcagctgtggcaatggttgcaccacggtcagcacctggatgatggcacagcc
atcgatcaacacctgctgcaggcgaccctgcgcgcactgcccgcacggttgggaaccgcc
accgcgctgcccggcgctgcacggatcgatgaagcgatcgccttgctcgaagagttgagc
ggcgccgacgaactggcggacttccttactgtaccggcgtaccgcctgatcgactga

DBGET integrated database retrieval system