KEGG   Xanthomonas citri pv. citri 306: XAC0257Help
Entry
XAC0257           CDS       T00084                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00630  Glyoxylate and dicarboxylate metabolism
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01200  Carbon metabolism
Module
xac_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XAC0257 (aceA)
Enzymes [BR:xac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XAC0257 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAM35149
UniProt: Q8PQR5
Position
306512..307807
Genome map
AA seq 431 aa AA seqDB search
MSTTLQSAEQLQQDWSNNPRWAGIARNYSAADVARLRGTVHVEHSLARLGAEKLWNSLHA
TPFVNALGALTGNQAMQQIKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNHSMFHLAH
GYARRQMSAFVELQQAEFEAAEMGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEEQFQSDKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcactacactgcaaagcgccgaacaactgcagcaggactggtccaacaaccctcgc
tgggccggcatcgcccgcaattacagcgctgccgatgtggcgcgcctgcgtggcaccgtg
catgtcgagcattcgctggcacgcctgggtgcagaaaaactgtggaattccctgcatgcc
acaccgttcgtcaatgcgctgggcgcgctgaccggcaaccaggccatgcaacagatcaag
gccggcctgaaggcgatttacctgagcggttggcaggttgccgccgatgccaatctggcc
gggcagatgtatccggatcaatcgctatacccggccgattccgtgccggcggtggtcaag
cgcatcaacaataccttgctgcgcgccgaccagctccatcatgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggtttcggcggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggtgcggccggtgtgcacttcgaagac
cagctggcctcggtcaagaaatgcggccatatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggccgccgatgtgctgggcgtgccgacg
gtgctgatcgcgcgcacagacgccgaagccgccgacctgatcaccagcgatgtggatgcc
aacgatcaaccgttcaccaccggcgagcgtacggtcgaaggcttcttcaagacccgcaat
ggcctggaccaggcaatcagccgcggcttggcctatgccccgtacgccgatctgatctgg
tgcgaaacgggcaagccggacctggaatttgcgcgcgccttcgcacaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaactggaagaagaat
ctggacgacgccaccattgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggccggtttccatgcgttgaatcacagcatgttccatctggcgcac
ggctatgcgcgccggcagatgagcgcattcgtcgaattgcagcaggccgagttcgaggcg
gcggagatgggatttaccgcagtcaagcatcagcgcgaggtgggcaccggctatttcgat
gcagtgacgcaggcgatccagcaggggcaatcgtccacgaccgcgttgcgtggctccact
gaagaagagcaattccaaagcgacaaggcggcctga

DBGET integrated database retrieval system