KEGG   Xanthomonas citri pv. citri 306: XAC0257Help
Entry
XAC0257           CDS       T00084                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC0257 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XAC0257 (aceA)
Enzymes [BR:xac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XAC0257 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306512..307807
Genome map
AA seq 431 aa AA seqDB search
MSTTLQSAEQLQQDWSNNPRWAGIARNYSAADVARLRGTVHVEHSLARLGAEKLWNSLHA
TPFVNALGALTGNQAMQQIKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNHSMFHLAH
GYARRQMSAFVELQQAEFEAAEMGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEEQFQSDKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcactacactgcaaagcgccgaacaactgcagcaggactggtccaacaaccctcgc
tgggccggcatcgcccgcaattacagcgctgccgatgtggcgcgcctgcgtggcaccgtg
catgtcgagcattcgctggcacgcctgggtgcagaaaaactgtggaattccctgcatgcc
acaccgttcgtcaatgcgctgggcgcgctgaccggcaaccaggccatgcaacagatcaag
gccggcctgaaggcgatttacctgagcggttggcaggttgccgccgatgccaatctggcc
gggcagatgtatccggatcaatcgctatacccggccgattccgtgccggcggtggtcaag
cgcatcaacaataccttgctgcgcgccgaccagctccatcatgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggtttcggcggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggtgcggccggtgtgcacttcgaagac
cagctggcctcggtcaagaaatgcggccatatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggccgccgatgtgctgggcgtgccgacg
gtgctgatcgcgcgcacagacgccgaagccgccgacctgatcaccagcgatgtggatgcc
aacgatcaaccgttcaccaccggcgagcgtacggtcgaaggcttcttcaagacccgcaat
ggcctggaccaggcaatcagccgcggcttggcctatgccccgtacgccgatctgatctgg
tgcgaaacgggcaagccggacctggaatttgcgcgcgccttcgcacaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaactggaagaagaat
ctggacgacgccaccattgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggccggtttccatgcgttgaatcacagcatgttccatctggcgcac
ggctatgcgcgccggcagatgagcgcattcgtcgaattgcagcaggccgagttcgaggcg
gcggagatgggatttaccgcagtcaagcatcagcgcgaggtgggcaccggctatttcgat
gcagtgacgcaggcgatccagcaggggcaatcgtccacgaccgcgttgcgtggctccact
gaagaagagcaattccaaagcgacaaggcggcctga

DBGET integrated database retrieval system