KEGG   Xanthomonas citri pv. citri 306: XAC0358Help
Entry
XAC0358           CDS       T00084                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    XAC0358 (glpK)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     XAC0358 (glpK)
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XAC0358 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(426815..428332)
Genome map
AA seq 505 aa AA seqDB search
MFEESSMEKQYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWVEHNPREIMT
SVYTTITELLNNAQIDARAIAGIGITNQRETAVVWDKATGQPIYNAIVWQSRQTKDICAQ
LKEAGHEQMVRDKTGLLIDAYFSGTKVKWILDHVEGARERAQKGELAFGTIDSWLIWNLT
GGKVHVTDYTNASRTMMFNIHTLQWDAELLAMLDVPAQMLPEVRSSSEVYGMTQTQYFYG
EQVPIAGIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMNTGDKAVASKAGLLTTIAWGI
DGKVEYALEGAIFVAGSVVQWLRDGLRMLGKASDSQAYAERAGDNDGVYIVPAFVGLGAP
YWRSDIRGAVFGLTRGTTKEHFVRAAVESMAYQTRDVLTAMQSDSGIELKELRADGGAIA
NDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLATGFWSSREEIAKQWAVDRRFEPAM
ADDKRQALYAGWQQAVEATMGFRIS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaggaatcttcgatggaaaagcagtacgtccttgcgatcgatcaaggcaccacc
agctcacgcgcgatgttgttcgaccgccagggcaaggtggccggcgtggcgcagcgcgaa
ttcggccagatcttcccgcagcctggctgggtggaacacaacccgcgcgagatcatgacc
agcgtctataccaccatcaccgagctgctcaacaacgcgcagatcgatgcgcgcgcgatc
gccgggatcggtatcaccaaccagcgcgagaccgcagtggtgtgggacaaggccaccggc
cagccgatctacaacgccatcgtgtggcaatcgcggcagaccaaggacatctgcgcccag
ctcaaggaagccgggcatgagcagatggtgcgcgacaagaccggtttgctgatcgatgcg
tacttttccggcaccaaggtcaagtggattctcgaccatgtcgaaggcgcgcgcgaacgc
gcgcagaaaggcgaactggcgttcggcaccatcgacagctggctgatctggaatctcacc
ggcggcaaggtgcacgtcaccgactacaccaatgcctcgcgcaccatgatgttcaacatc
cacacgcttcagtgggatgctgaactgctggcgatgttggacgtccccgcgcagatgctg
ccggaagtgcgttcgtccagcgaggtgtatggcatgacccagacccagtatttttacggc
gaacaggtacccatcgctggcatcgccggcgaccagcaggccgcgttgttcggccaggcc
tgtttcgagccgggcatggcgaaaaacacctacggcaccggctgtttcatgctgatgaac
accggcgacaaggcggtggcatccaaggctggcttgttgaccacgattgcctggggcatc
gacggcaaggtcgaatacgcattggaaggcgcgatcttcgttgccggctcggtggtgcag
tggctgcgcgacggcttgcgcatgctgggcaaggccagcgactcgcaggcctacgccgag
cgtgccggcgacaacgatggcgtgtacatcgtgccggccttcgttggcctgggcgcgccg
tactggcgcagcgacattcgcggcgccgtgttcgggttgacgcgtggcaccaccaaggaa
cacttcgtgcgtgcggcagtcgaatcgatggcctaccagacccgcgatgttcttaccgca
atgcagagcgattccggcatcgaactgaaagagctgcgtgccgacggcggcgccatcgcc
aacgacttcatggcgcagttccagagcgacatcctcaatgtgccggtactccgcccggag
gtggccgaaaccactgcactgggcgcggcgtacctggccgggctggcaaccgggttctgg
agcagccgcgaagaaatcgccaagcaatgggcagtggatcgccgcttcgaaccggccatg
gccgacgacaagcgccaagccttgtacgccggctggcagcaagcagtggaagcgacgatg
gggttccgcatcagctga

DBGET integrated database retrieval system