KEGG   Xanthomonas citri pv. citri 306: XAC0426Help
Entry
XAC0426           CDS       T00084                                 

Gene name
glgB2
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XAC0426 (glgB2)
Enzymes [BR:xac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XAC0426 (glgB2)
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XAC0426 (glgB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503085..505268
Genome map
AA seq 727 aa AA seqDB search
MTTEGISEMSQTLQALADGLPADAFAVLGPKLLADGRRQVRVLAPGAEAMGLIDPRGKLL
ARMQASAIDGVFEGTLAVDGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQA
LRRALGAQHLHCGDVPGVRFALWAPHAQRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPR
VDAGARYKYAVTAADGRVLLKADPVARQTELPPATASVVPSAATFAWTDAAWMANRDPAA
VPGPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWG
YQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEH
ADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIEHYHLDGLRVDAVASMLYRDYGRAE
GEWVPNAHGGRENLEAVAFLRQLNRDIATQFPGVLTIAEESTAWPGVTAAISDGGLGFTH
KWNMGWMHDTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQM
PGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQ
LVGDLNAALRRTPALYRGTHRAEGFDWSVADDARNSVLAFVRHDPDGGAPLLAVSNLTPQ
PHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTLPPLAT
IYLQAEK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggaagggatctcggaaatgtcgcagaccctgcaagccctggccgacggcttg
ccggccgatgcctttgcggtgcttggaccgaagctgctggccgatggccgccgtcaggtg
cgcgtgttggccccgggtgccgaggcgatgggcttgatcgacccccgcggcaagctgctc
gcgcgcatgcaggccagcgccatcgatggcgtcttcgaaggcactctggcggtcgatggg
ccgtaccggctgcgtatcgtgtggccagaccgggtgcaggaggtcgaagacccgtacgcg
tttgcggccacgctggacgaatcgctgttgctgcagatcgctgcaggcgacggccaggcg
ttgcgccgtgcgctgggcgcgcagcatctccactgtggcgacgtgccgggcgtgcgcttc
gcgctgtgggcaccccatgcccagcgcgtggcggtggtcggcgacttcaacggatgggac
gtgcggcggcatccgatgcggcagcgcatcggtggcttctgggaactcttcctcccgcgc
gtggacgctggcgcccggtacaagtatgccgtcaccgcagccgatgggcgggtgctgctc
aaggccgacccggtggcgcggcagaccgaattgccgccggcaaccgcatcggtggtgccc
agcgccgccacattcgcctggaccgacgcggcctggatggccaaccgcgaccccgccgcc
gtgccggggccgctgtcgatctacgaggtgcatgccgcgtcctggcgtcgcgacggacac
aaccagccgctggactggccaaccctggccgagcagttgattccctatgtgcagcagctc
ggcttcacccatatcgaattgctgccgatcaccgaacacccgtttggcggttcctggggc
tatcagccgctgggcctgtatgcgcccaccgcgcgccatggcagcccggacggctttgcg
cagttcgtcgacgcctgccatcgcgccggtatcggcgtgatcctggattgggtcagtgcg
cactttcccgatgacgcgcacgggctggcccagttcgacggcgccgcgctgtatgagcat
gccgacccgcgcgaaggcatgcatcgcgactggaatacgctgatctacaactacggccgg
ccggaagtgaccgcttacctgctgggcagcgcgctggaatggatcgagcattaccacctc
gacggcctgcgcgtggatgcggtggcctcgatgctgtatcgcgactacggccgtgccgaa
ggcgagtgggtgcccaacgcgcatggcggccgcgagaatctggaggcggtcgcgttcctg
cgccagctcaaccgcgacatcgccacgcagttccccggcgtgctcaccatcgccgaagaa
tcgaccgcctggccgggcgtgaccgccgcgatcagcgatggcggcctgggcttcacgcac
aaatggaacatgggctggatgcacgacacgctgggctacatgcagcgcgatccggccgaa
cgtgcgcatcaccatagccagctcaccttcgggctggtgtacgcattcgacgaacgcttc
gtgttgccgctctcccacgatgaagtggtgcacggcaccggtggcctgctcgggcagatg
ccgggcgacgactggcgccgcttcgccaacctgcgcgcctatctggccctgatgtgggcg
cacccgggcgacaaactgctgttcatgggcgccgaattcgggcaatgggccgactggaat
cacgaccagtcgctggattggcatctgctggatggcgcgcggcatcgtggcatgcagcaa
ctggtgggcgatctcaacgccgcactgcgccgcacgccggcgctgtatcgcggcacccat
cgcgctgaaggcttcgactggagcgtggccgacgatgcgcgcaacagcgtgctggcgttc
gtccgccacgatcctgacggtggcgcaccgttgctggcagtgagcaacctcaccccgcaa
ccgcaccacgactatcacgtgggggtgccgcgtgccggcctctggcgcgagatcctcaac
accgacagtgcccattacggcggcagcaacctcggcaacagcggtcgcttggcgaccgag
ccggtgggcatgcatgggcatgcgcaacgtctgcgcctgaccctgccgccgctggccacg
atctatctgcaagcggagaaataa

DBGET integrated database retrieval system