KEGG   Xanthomonas axonopodis pv. citri 306: XAC0428Help
Entry
XAC0428           CDS       T00084                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xac00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
507025..508974
Genome map
AA seq 649 aa AA seqDB search
MSARDHGGDDLGTLAAAAGVMVDWVDASDQPRQVCEQSVHAVLSALELPAATAAQRADSL
RRCQAQATEAAPLLTVQVGQPLPLRVAAHAGGRWTDDSGASEDARADAQGHLRAPRRFGY
WTLQIGAITQQVAVAPPRCFSVADACGQPSPRAWGMALQVYSARSLDDGGIGDAAGTVEW
LRYAALAGADALALSPVHASRPVTGAYSPYSPSDRRFLDPLHAAPVRILGELALDAINAV
PGLRERFDGLHNAALIDWQASAHAKWELLRQLYTRVSPDHADLVAFRNAGGAALEGFARF
AAQDFGDNDPQLHVFTQWLAARSWSDAQREAHERGMKIGLIADLAVGFDPNGAEAAAAAD
TVLRGLVLGAPPDAFNADGQHWGIGAYSPTALRRSGYAPYIALLRAVLHDRGGIRIDHIL
GLMRLWVVPDGASSNEGAYLAYPLHDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSQ
RGVMGIDVLMFTRNDDGAFVSPTLWRPDAIATTTTHDLPTLTGWRTGRDIEWRRKLELIQ
PAQASDDAAARDKDVARLDAAVEHAGLSNARAPLLGALRFTATSVSPLALLPVEDALALD
EQPNLPGTVEVHPNWRRRLPDPLPHARLSSALQGFAEARRVAAVSEPHP
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgcgcgatcacggtggggacgacctcggcaccctggccgccgcggccggggtg
atggtggattgggtggatgccagcgaccagccgcggcaggtctgcgagcaatcggtacat
gcagtgctcagcgcgttggaactgccggccgccaccgcggcgcaacgcgccgatagcctg
cgccgctgccaggcgcaggccactgaagccgcaccactgttgacggtgcaggtgggccag
ccgctgccgttgcgcgtggcggcacacgccggtggccgctggaccgacgacagtggcgcc
agcgaagacgcacgcgccgatgcgcaaggacacctgcgcgcgccgcggcgtttcggttac
tggacgctgcagatcggcgcgatcacccagcaggtggccgtggcgccgccacgctgcttc
agcgtggccgatgcctgtggccaaccatcgccgcgtgcctggggcatggcgctgcaggtg
tactcggcacgcagcctggatgacggcggtatcggcgatgccgccggcacggtggaatgg
ttgcggtacgcggccttggccggcgccgacgccctggcattgagtccggtgcacgcctcg
cgcccggtgacgggcgcttacagcccgtattcgcccagcgatcgccgctttctcgatccc
ttgcatgccgcaccggtgcgcattcttggcgaactggcgctggatgcaatcaacgcggtg
cccggcctgcgcgaacgtttcgatggcttgcacaacgctgcattgatcgactggcaggcc
tcggcgcacgccaagtgggaattgctgcgccagttgtacacgcgcgtttcgcccgatcat
gccgatctggtcgccttccgcaacgcaggcggcgcagcactggagggctttgcacgcttt
gctgcgcaggatttcggcgacaacgatccgcagctgcatgtgttcacgcaatggctggca
gcgcgcagctggtccgatgcgcagcgcgaggcgcacgagcgcggcatgaagatcggtttg
atcgccgatctggcggtgggcttcgaccccaacggcgccgaagccgctgcagcagccgac
accgtgctgcgcggcctggtactgggcgcgccgccggatgccttcaatgccgatggtcag
cattggggcatcggtgcgtactcgcccaccgcgctgcggcgcagcggctacgcgccgtat
atcgcgctgctgcgcgcggtgctgcacgaccgcggcggcatccgcatcgatcacatcctg
ggcctgatgcggctatgggtggtgcccgatggcgccagctccaacgaaggtgcgtatctg
gcctacccgttgcacgatctgctcaacctgctcgcgctggaatcgtggcggcaccgggcg
atcgtcatcggcgaggatctgggcgtggtgccgccgggtatccgcgaagaactctcgcag
cgtggggtgatgggcatcgatgtgttgatgttcacgcgcaacgatgatggcgcattcgtc
tcgccgacgctgtggcgaccggacgcgatcgccaccaccaccacgcacgatctgcccacg
ctcaccggctggcgcaccggccgcgatatcgaatggcggcgcaagctggaattgatccag
cctgcacaggccagcgacgatgccgccgcgcgcgacaaggacgtggcacggctggatgcc
gctgtcgaacacgccggcctgagcaatgcgcgcgccccgctgctgggcgcgttgcgcttc
accgccaccagtgtctcgccgctggccttgttgccggtggaagacgcactggctctggac
gaacaacccaacctgccgggcaccgtcgaagtgcatcccaactggcgtcgacgcctgccc
gatcccttgccgcatgcgcgcctgagttcggcgctgcagggctttgccgaggcgcgtcgc
gtcgcggccgtttcggaaccgcatccatga

DBGET integrated database retrieval system