KEGG   Xanthomonas citri pv. citri 306: XAC0481Help
Entry
XAC0481           CDS       T00084                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01130  Biosynthesis of antibiotics
xac01230  Biosynthesis of amino acids
Module
xac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XAC0481 (trpC)
Enzymes [BR:xac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XAC0481 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAM35372
UniProt: Q8PQ47
Position
571700..572497
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAMQASIAAGDPAVIAEV
KKASPSKGVIRPDFQPADIAVSYEFGGATCLSVLTDVDFFQGSDAYLRQARDACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDAQLADLSGLAMQLGLDVLVEVHDIDELERA
VQVPVPLIGINNRNLRTFEVTLQTTLDMRSAVPRDRVLVTESGIVTQADVQRMRSHDVNA
FLVGETFMRAAEPGESLRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcaacaccattcttgcccgcaaggccgatgaagtcgccgagcgcagt
gcgcgcgtgccgctggccgagttgattgcgcgcagcgccgacctgccgctcacgcgcgga
tttgcagctgccatgcaggccagcatcgccgcaggcgacccggccgtgattgccgaagtg
aagaaggccagcccgtccaagggtgtcatccggccggacttccagccggccgatatcgcg
gtcagctacgaattcggtggcgcgacgtgcctgtccgtgctcaccgatgtggatttcttc
cagggatccgatgcctatctgcgccaggcgcgcgacgcctgcacgctgccggtgctgcgc
aaggatttcaccgtggacccgtatcaggtctacgaagcccgcgtgctcggcgccgactgc
atcctgttgatcgtctccgcgctggaagacgcccaactggccgatctatcgggtcttgcc
atgcagctgggcctggacgtgctggtggaagtgcacgatatcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgttgatcggcatcaacaaccgcaacctgcgcaccttcgaagtg
acgctgcagaccacgttggacatgcgctccgcggtgccgcgcgatcgcgtgctggtcacc
gagagcggcatcgtcacccaggccgatgtgcaacggatgcgcagtcacgatgtgaacgcg
tttctggtcggcgagaccttcatgcgcgcggcagaacccggcgagtcgctgcgtcagcta
ttcttcgcgcatgactga

DBGET integrated database retrieval system