KEGG   Xanthomonas axonopodis pv. citri 306: XAC0775Help
Entry
XAC0775           CDS       T00084                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:xac00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:xac00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918427..919914
Genome map
AA seq 495 aa AA seqDB search
MSRSMALSQLLPDVALTHDVQVSGLVMDSRAVRPGDAFVAIAGFGAHGLGFVEQARANGA
AAVLFEPPAPDGLPVPADAIAVPGLRARLGVMADQFHGRPSQAMRMVGVTGTNGKTSTVQ
LLAQALTLLGTPTGTLGTLGVGLYGAAVPTGFTTPLVLPTHALLAQLRDDGAQAVAMEVS
SHALDQGRVDAVHFDVAVFTNLTRDHLDYHGDMAQYGAAKAKLFARAGLKAAVVNLDDAF
GHTLFAALDPALRAIGVSSRAHADASVSAQALQLDHNGINFALNIRGQVHPVHSPLLGRF
NVDNLLAVAGALWAMEFAPAQIASVLGQLQPIHGRMNRLGGAHGAPLVVVDYAHTPDALE
QALSSLRSHAQDRLICVFGCGGERDTGKRPQMAAIAELKADVAIVTDDNPRGEDGDAIVA
DILRGFARPDAAIVQRDRAAAIHQAIGMASPSDIVLIAGKGHEPYQEVAGVRHAFDDALV
AAQALLPRTVLGVRP
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgctccatggcgctctcgcagttgctgccggacgtggcgttgacgcacgacgtg
caggtgtccgggctggtgatggatagccgtgccgtgcgtccgggcgatgccttcgtggca
atcgccggtttcggtgcgcatggtctgggctttgtcgaacaggcgcgcgccaatggcgca
gcggcggtgttgttcgagccgccggctcccgatggactgccggtcccggccgatgcgatt
gccgtgcccggtttgcgtgcgcgcctcggcgtgatggccgatcaattccatggccggccg
tcgcaggcgatgcgtatggtcggcgtcaccggtaccaacggcaagacctccaccgtgcag
ttgctggcgcaggcattgacgctgctcggtacgcccaccggcacgcttggcaccttgggc
gtcggtctgtatggcgcggccgtgccgaccggtttcaccacgccgctggtgctgcccacg
catgccttgctggcgcagttgcgcgatgacggtgcgcaggccgtggcaatggaagtcagc
tcgcacgcgctcgatcagggccgcgtggatgcggtgcatttcgacgtggcggtgttcacc
aatctcacccgcgaccatctcgattaccacggcgacatggcgcagtacggtgcggcgaag
gccaagctgttcgcccgcgcggggttgaaagcggccgtggtgaacctggacgatgcgttc
ggccacacactgttcgctgcgctcgatcccgcgctgcgcgcgatcggtgtgagctcgcgc
gcgcatgccgacgccagcgtgagcgcgcaggcactgcagctggaccacaacggcatcaat
ttcgcgctcaatatccggggccaggtgcatccggtgcattcgccgctgctgggccgtttc
aacgtggacaacctgctggccgtggccggcgcgttgtgggcgatggagtttgcgcctgcg
cagatcgccagcgtgctcggccagttgcagcccatccatggccgcatgaaccgccttggt
ggcgcacatggcgcaccgttggtggtggtcgattacgcacacacgcccgatgcgctggag
caggcattgagcagcctgcgctcgcatgcgcaggaccgcctgatctgcgtgttcggctgc
ggtggcgagcgcgacaccggcaagcgcccgcagatggcggcgatcgccgagctcaaggcc
gacgtggcgatcgtgaccgacgacaacccgcggggcgaggacggcgatgcgatcgtggcc
gatatcctgcgcggcttcgcgcgaccggatgcggccatcgtgcagcgcgaccgcgctgct
gcgatccatcaggccatcggcatggccagcccatcggacatcgtgttgatcgccggcaag
ggccacgagccgtatcaggaagttgccggcgtgcggcatgccttcgacgacgccctcgtg
gcggcgcaggcgctgctgccacggaccgtattgggagtgcgcccatga

DBGET integrated database retrieval system