KEGG   Xanthomonas axonopodis pv. citri 306: XAC0844Help
Entry
XAC0844           CDS       T00084                                 

Gene name
folA
Definition
dihydrofolate reductase type III
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xac00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:xac00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003651..1004145
Genome map
AA seq 164 aa AA seqDB search
MKLTLIVAFDRNNAIGRDNDLPWKLPDDLKRFKALTLGKPILMGRKTAQSLGRALPERLN
LVLTRSGQVPFEGMHAVASVEQAIERAAQDGAQELCVIGGGEVYRLTMQRADLLAVTEVD
TVVDGADTHFPPIDPALWEAVQRESHAADARHAFAFDYVDYRRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaccctgatcgtcgccttcgaccgcaacaacgccatcggtcgcgacaacgac
ctgccgtggaaactgcccgacgatctcaagcgcttcaaggcgctgacgctgggcaagccg
atcctgatggggcgcaagacggcgcaatcgctggggcgtgcgttgccggagcgattgaac
ctggtgctgacgcgttcggggcaggtgccgttcgagggcatgcatgcggtggcatcggtg
gaacaggcgatcgagcgcgctgcgcaggatggcgcgcaggagctgtgcgtgatcggcggc
ggcgaggtgtatcggctgaccatgcaacgtgccgatctgctggcggtgaccgaagtagac
acggtagtggatggcgccgatacgcatttcccgccgatcgaccctgcgctgtgggaggcc
gtgcagcgcgaatcgcacgcggccgatgcccggcatgcgttcgcattcgactatgtggac
tatcggcggcgttga

DBGET integrated database retrieval system