KEGG   Xanthomonas citri pv. citri 306: XAC1063Help
Entry
XAC1063           CDS       T00084                                 

Gene name
p13
Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xac  Xanthomonas citri pv. citri 306
Brite
Enzymes [BR:xac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     XAC1063 (p13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1220880..1221329)
Genome map
AA seq 149 aa AA seqDB search
MSESIRIATPLTKLSEGLRLRSYVCPAGKLTIGYGHTGYDVTPGLTITQERADALLEADL
AKALAGVRKYVHVPLTAQQEAALVDFVFNLGAERLRTSTLLRLLNSGNYASVSTQLPRWV
YGEVNGKAKRLPGLIVRRRANVAMWETRS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaatccatccgcatcgcaaccccgctcaccaagttgagtgagggtttgcgcctt
cgctcctacgtgtgcccagccggcaagctgaccatcggatacggccacacaggctacgac
gtaacccctggactgacgatcactcaggagcgcgctgatgcgctgctggaggccgacctg
gcaaaggccttggccggcgtaaggaagtacgtgcacgtgcccctcacagcgcagcaggag
gctgccctagtggatttcgtgttcaacctaggggccgagcgccttcgcacctcgaccctg
ctacgtttgcttaactccggcaactacgcatcagtatccacgcagctgccacgttgggtg
tacggtgaggtcaacggcaaggccaaaaggcttcccggcctcatcgtccgccgcagggcg
aacgtggcgatgtgggaaacgcgctcatga

DBGET integrated database retrieval system