KEGG   Xanthomonas axonopodis pv. citri 306: XAC1111Help
Entry
XAC1111           CDS       T00084                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XAC1111 (recR)
DNA repair and recombination proteins [BR:xac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XAC1111 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262303..1262896
Genome map
AA seq 197 aa AA seqDB search
MSTLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALGSAVEKVGHCVQCRD
FTESEICTICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFILQGRLSPLDGIGPREL
GLDRLSERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctgctcgaacaactgatcgaggccttccgggtattgcccggtgtgggccag
aaatcggcgcaacgcatggcctatcacgtgctcgaacgcgagcgtgagggcgggcgtcgg
cttgccgctgcgttgggcagcgcggtggaaaaggtggggcattgcgtgcagtgccgcgac
ttcaccgaatcggaaatctgcaccatctgcgccagcagcagccgcgaccggcagcagctg
tgcgtggtggagtcgccggccgaccgcctggcgatcgagcacgccaccggctaccgcggg
ctgtatttcatcctgcaggggcgcctgtcgccgctagatggcatcggcccgcgcgaactg
gggctggaccggctcagtgaacgtctggctgctggcgaagtgaccgaaatgatcatcgcc
accaacgccaccgtggaaggcgaggcaaccgcccattacctggcgcagcttgcccgccag
cacgcagtgcgcccgagccggcttgcccagggcatgccactgggcggcgagctggagtac
gtggaccgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctttga

DBGET integrated database retrieval system