KEGG   Xanthomonas axonopodis pv. citri 306: XAC1176Help
Entry
XAC1176           CDS       T00084                                 

Gene name
srfJ
Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    XAC1176 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XAC1176 (srfJ)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     XAC1176 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337952..1339271
Genome map
AA seq 439 aa AA seqDB search
MRVSTAAAPANGHPLTEKENSIFVNPQRQFQELLGIGGAITDSSAETFAKLPKRAQRALL
TAYYDPQQGIGYTLARTTIHSSDFSSGSYTYIKEGDAALKSFSVKHDAKYRIPMLRQAIA
AAGGKLTTFASPWSAPAFMKDSNNMLKGGKLLPEYAQAWASYYTRFIAAYEKAGIPIWGI
SLQNEPMAVQTWESMLFPAEEERDFLKHHLGPTMASAGYGERKIIVWDHNRDMMVHRAHV
IFDDPEAAKYAWGMGFHWYETWAGFEPMVENVAAVAQAYPDKHLLLTEAAVEKFDPAKLQ
YWPNGERYGTAIINDLNHGAVGWTDWNILLDQHGGPNHVGNYCFAPVHADTRTGEVIYTP
SYWYIGHFSKFIRPGARRVSSASSRSNLATTAFLNTDGSLAMVVMNAGDVAIAYNLYVGE
ASSTLEIPAHAIQTVVLAQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcagcacggctgctgctcctgccaacgggcatccgctgaccgaaaaagaaaac
tccatcttcgtcaatccgcaacggcaatttcaggaactgttgggcatcggtggcgcgatc
accgattccagcgcagagacctttgccaagctgcccaagcgtgcgcaacgtgcgctgctc
acggcgtactacgatccgcagcagggcattggctacacgctggcgcgtaccaccatccat
agctcggatttcagcagcggcagctacacctacatcaaggagggcgatgcggcgctgaag
agtttttcggtcaagcacgatgccaagtaccgcatcccgatgttgcgccaggcgattgcg
gcggccggcggcaagctcaccacgtttgccagcccatggagcgcgccggccttcatgaaa
gacagcaacaacatgctcaagggcggcaagctattgcccgagtacgcgcaggcctgggca
agctactacacgcggtttatcgcggcatacgaaaaagcgggcatcccgatctggggcatc
agcctgcagaacgagccgatggcggtgcagacctgggagtcgatgctgtttccggccgag
gaagagcgcgacttcttgaagcatcatcttgggcccaccatggccagcgccggctacggc
gagcgcaagatcatcgtgtgggaccacaaccgcgacatgatggtgcaccgcgcgcatgtg
atcttcgatgacccggaggcggcaaaatatgcatggggcatgggcttccattggtatgaa
acctgggccggattcgagccgatggtggagaacgtggcggcagtggcgcaggcgtacccg
gacaagcacttgctgttgaccgaagcggcggtggaaaagttcgacccggccaaattgcag
tattggcccaatggcgaacgctacggcacggccatcatcaacgacctcaatcatggcgca
gtgggctggacggactggaacattctgctcgaccagcatggtgggccgaaccacgtgggc
aattactgctttgcgccggtgcatgccgatacgcgcacgggcgaggtgatctatacgccg
agctattggtatatcggccacttttccaaattcatccggccgggcgcacggcgggtcagc
tcagccagcagccgtagcaatctggcgaccacggcgttcctcaacaccgatggcagcctg
gccatggtggtcatgaatgccggcgacgttgcgattgcttacaacctgtatgtgggcgag
gcatccagtacgttggagattccggcgcatgcgatccagaccgtggtattggcgcagtaa

DBGET integrated database retrieval system