KEGG   Xanthomonas citri pv. citri 306: XAC1318Help
Entry
XAC1318           CDS       T00084                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC1318 (fadB)
   01212 Fatty acid metabolism
    XAC1318 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XAC1318 (fadB)
   00650 Butanoate metabolism
    XAC1318 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    XAC1318 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    XAC1318 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XAC1318 (fadB)
   00310 Lysine degradation
    XAC1318 (fadB)
   00380 Tryptophan metabolism
    XAC1318 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XAC1318 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XAC1318 (fadB)
   00281 Geraniol degradation
    XAC1318 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XAC1318 (fadB)
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XAC1318 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XAC1318 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XAC1318 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1521745..1523826)
Genome map
AA seq 693 aa AA seqDB search
MLPGFDGLRFSHWQADLREDGVVVLSLDRQGAPVNAFSQEVLLELGALVERLALDPPTGV
VLRSGKPNGFIAGADLKEFQEFDRKGTVNDAIHRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLTGRTVS
AKAARAMGLVDKVAAPAVLVDAAASLALAGTTRAFKQRATAWATNTLLARKLLAPQMRKQ
VGRKARKEHYPAPYALINVWERAGGSGIQARLAAERKAVVKLASTPTARNLIRIFFLTER
LKGLGGKDAAGVAVAPIRHVHVIGVGVMGGDIAAWAAYKGFDVTLQDREQRFIDTALTRG
GELFAKRVKDDAKRPAVAARLRGDLAGAGVTQADLVIEAIIENPQAKRDLYQSIEPQLKP
DALLTTNTSSIPLTDLRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLAAF
CKTLDKFPVPVAGTPGFLVNRVLFPYLLEAATAYAEGIPGPVLDKTAVKFGMPMGPIELI
DTVGLDVAAGVGAELAPFLRLPIPAALATVEAGKRGKKDGQGLYKWENGRAVKPEVASGY
AAPADLEDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQYIRSVGAD
ALLERLQALHARYGERFAPRPGWDSPLLREAVA
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggccgatctgcgcgaggac
ggcgtggtcgtgctcagcctcgatcggcagggcgcaccggttaacgcattttcgcaggag
gtactgctggagctgggcgccttggtcgaacggctggcgctggatccgccaacgggtgtg
gtgctgcgttcgggcaagcccaacggcttcatcgccggtgccgatctgaaggaattccag
gaattcgaccgcaagggcacggtcaacgatgcgatccatcgtggacagcaggtcttccag
aagctagccgaactaccgtgccccaccgtcgcggcgattcacggcttctgcatgggcggc
ggcaccgaaatcgcgctggcctgccgctaccgcgtggcttccgacgatggcagtacgcgc
atcggactgccggaaaccaagctcggcatcttccctggttggggcggcagcgcccgcttg
ccgcgcctgatcggtgcgccggcggcgatggatctgatgctcaccggccgcacggtgtcg
gccaaggccgcgcgcgcgatgggcctggtcgacaaggtcgccgcgcctgccgtgctggtg
gatgcggccgccagcctggcgctcgccggcaccacccgtgcgttcaagcaacgcgccacc
gcatgggccaccaacaccttgctggcgcgcaaactgctggcgccgcagatgcgcaagcag
gtggggcgcaaggcgcgcaaggagcattacccggcgccctatgccttgatcaacgtctgg
gagcgggcgggcggtagcggcatccaggcgcgcctggcggccgaacgcaaggcggtggtc
aaactcgccagcacgccgaccgcacgcaacctgatccggatcttcttcctgaccgagcgt
ctgaaagggctgggcggcaaggacgcagccggcgtggccgtagccccaattcgccatgtg
catgtgatcggcgtcggcgtcatgggcggcgatatcgccgcctgggcggcttacaagggc
ttcgacgtcacattgcaggaccgcgagcagcgttttatcgatacggcgctgacacgcggt
ggcgagctgttcgccaagcgcgtcaaggacgatgccaagcggccggcagtggcggcgcgt
ctgcgcggcgacctggccggcgcgggcgtgacgcaggccgacctggtgatcgaggcgatc
atcgaaaacccgcaggccaagcgcgatctgtatcaatcgatcgagccgcaactcaagccg
gatgcattgctgacgaccaatacctcgtcgattccgctgaccgacttgcgtggccacatc
cagcgcccggcgcaatttgccggcctgcactacttcaacccggtggcgatgatgccgctg
gtggaaatcgtgcagcacgatggcctggatccggccaacgtcgcgcgcctggctgcgttc
tgcaagaccttggacaagttcccggtgccggtggccggcacgccgggtttcctggtcaac
cgggtgctgttcccctacctgctcgaagcggccaccgcgtatgccgagggcattcccggc
cccgtgctggacaagacggcagtgaagttcggcatgccgatggggccgatcgaattgatc
gacaccgtgggcctggatgtggcggccggcgtgggtgccgagttggcgccattcctgcgt
ttgcccatcccggcggcactggcgaccgtggaagccggcaagcgcggcaagaaggacggc
cagggcctgtacaagtgggagaacggacgcgccgtcaaacccgaggttgccagcggttac
gctgcaccggcggatttggaagatcgcttgatcctgccgctgctcaacgaagcggtagcg
tgcctgcacgacggcgtggtggccgacgcagacctgctggacgccggcgtcatcttcggc
acaggtttcgcacctttccgtggcggcccgatccaatacatccgcagcgtcggcgcagac
gcgctactggagcgcctgcaggccttgcatgcccgttatggcgaacgcttcgcgccgcgc
ccggggtgggactcaccgttgttacgggaagcggtggcctga

DBGET integrated database retrieval system