KEGG   Xanthomonas citri pv. citri 306: XAC1457Help
Entry
XAC1457           CDS       T00084                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XAC1457 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XAC1457 (gpo)
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XAC1457 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1683087..1683572
Genome map
AA seq 161 aa AA seqDB search
MSDISTFAFTDLEGRTQSMRDYAGNVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAAKIDVNGNGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALATEIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatctccaccttcgcattcaccgacctggaaggtcgcacccagtcgatgcgc
gattatgccggcaacgtactgctggtggtcaatgtcgcctccaagtgcgggtttacgccg
caatacgcggggctgcaggccctgtggcagcgttatcgcgaacgtggactggtagtgatc
ggttttccatgcgatcagttcgggcaccaggagccgggcgatgcggcgcagatccgccag
ttctgctcgctcgactatgcggtggattttccgctggccgcgaaaatcgacgtcaacggc
aacggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcgggtcc
gaggcgatcaagtggaacttcaccaagttcctgatcggccgcgacggccgcgtgctggaa
cgttatgcgcccaccaccaagccggaggcattggctaccgagatcgagcgcgcgctggac
gcatga

DBGET integrated database retrieval system