KEGG   Xanthomonas axonopodis pv. citri 306: XAC1733Help
Entry
XAC1733           CDS       T00084                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xac00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992383..1993285
Genome map
AA seq 300 aa AA seqDB search
MFETALTLDCAGRSLRLDAPQVMGIVNVTPDSFSDGGQHATCAAAIAHGLVLVEQGAAVL
DIGGESTRPGAAAVSVEEELQRVIPVIEALAQRTSVPISVDTFKPEVMRAAVAAGAGMIN
DVYALRSPGALEAASDLRVPVVLMHARSAPHAMQDAPHYDDVVGEVHRFLAERIFAAEMA
GIDKRRLVLDPGFGFDKTTTHNLTLLAQLQRLQEFGLPVLAGLSRKRSIGELTGREIAAD
RVHGSVAAHLIAAQHGALLLRVHDVAATVDALKVWKAMAAIPVPRVSAPATPAMRWPDED
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagaccgccctcacgctggattgcgccggccgcagcctgcgactggatgcgccg
caggtgatgggtatcgtcaatgtcacgcccgattcgttctccgacggcggccagcatgcg
acctgcgcagcggcgatcgcccatgggttggtactggttgagcagggcgctgcggtgctg
gatatcggtggtgagtccacccgcccgggcgctgcggcggtctcggttgaagaagaattg
cagcgggtcatcccggtcatcgaagcgctggcgcaacgtaccagcgtgccgatcagcgtg
gacacgttcaaaccggaggtcatgcgcgcggcggtcgcagccggcgccggcatgatcaac
gacgtctatgccctgcgttcgcccggtgcgctggaagcggcgtcggatctgcgcgtgccg
gtggtcttgatgcatgcgcgcagcgcgccgcatgccatgcaggacgcgccgcactacgac
gatgtcgtcggcgaggtgcaccggtttctggccgagcgcatcttcgccgccgagatggcc
ggaatcgacaagcgccggctggtcctggacccgggctttggcttcgacaaaaccaccacg
cacaacctcaccctgcttgcgcagctgcagcgactgcaggagttcggtttgcccgtgctg
gccgggctgtcgcgtaagcgcagcatcggcgagctgaccgggcgcgagatcgccgccgat
cgtgtgcacggctcggtggccgcgcatctgatcgccgcgcaacatggcgcgctgctgctg
cgcgtgcacgatgtggcggcaaccgtggatgcgttgaaggtgtggaaggcgatggcggcc
attcccgtcccgcgtgtcagcgcgcccgccacgcccgcgatgcgttggccggacgaggac
tga

DBGET integrated database retrieval system