KEGG   Xanthomonas axonopodis pv. citri 306: XAC1823Help
Entry
XAC1823           CDS       T00084                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XAC1823 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XAC1823 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XAC1823 (thrC)
Enzymes [BR:xac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XAC1823 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2118238..2119542
Genome map
AA seq 434 aa AA seqDB search
MFISTRGGAPAASLSQAIAAGLAPDGGLYVPQTLPPARTLVAGAGLADTATALLQPFFEG
DALAAELPAICAEAFDFPAPLVALGTPGDYALELFHGPTAAFKDFGARFLAACLTRLRRA
EDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGSFDDCQAMVKQALNDAALQTQVPLSSANSISLGRLLPQMSYYAHAALQHHAASGSVLN
LVIPTGNLGNALAAIIARALGVPLGRIALASNANHVLPDYFAGDAYAPQPSVSTLANAMD
VGAPSNFERLRWLYNGDDAALREEFRALSVDDAAIRNTVQQRFARYGEVHCPHTATAVHV
LEQLRAEGAEGGTGDWAVAATAHPAKFEGVVEPLIGRSVEVPPALAALLQRPAHAEALAP
DYAALRQRLLADAT
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctccacccgtggcggtgcccccgccgcaagcctgagccaagccattgccgcc
gggctggcgcccgatggcggcctctacgtgccgcagaccctgccacctgcccgtacgctg
gttgcgggcgccggcctggccgacaccgccactgcgctgttgcagccatttttcgagggc
gacgcactggcggccgaactgcctgccatctgtgccgaagccttcgatttcccggcgcca
ttggtggcgctgggtacgccgggcgattacgcgctggagctgtttcatggccccacggcg
gcgttcaaggatttcggtgcgcgcttcctggctgcctgcctgacccgcttgcgccgcgct
gaagaccgcccgctcaccatcctggtcgccacctccggcgacaccggcgccgccgtggcc
gccgcgttccatcgccagcccggcctgcgcgtggtggtgctgtatccggacggccgcgtg
tcgccgcggcaggcgcatcagttggggtgtttcggcgacaacatccaggccctgcgcgtg
gccggctcgttcgacgactgccaggcgatggtcaagcaggccttgaacgatgccgcgttg
cagacgcaggtgccgctgagttcggccaacagcatcagtctgggccggctgctgccgcag
atgagttactacgcgcatgccgccctgcagcatcatgcggcgtcgggcagcgtgctcaat
ctggtgatacccaccggtaacctgggcaacgcgctggcggcgatcatcgcgcgcgcgctc
ggggtgccgttgggccgcatcgcgctggcgtccaacgccaatcacgtgttgccggactat
ttcgcgggcgatgcctacgcaccgcagcccagcgtgtccaccctggccaatgcgatggac
gtgggcgcgccgagcaacttcgagcggctgcggtggctctacaacggcgacgatgccgcc
ttgcgtgaggaattccgggccttgtcggtggacgatgcggcgattcgcaacaccgtgcag
cagcgcttcgcgcgctacggcgaggtgcattgcccgcataccgccaccgcggtgcatgtg
ctcgaacaactgcgtgccgaaggcgcggagggcggcactggcgactgggcggtagcggcc
accgcgcatccggcaaagttcgagggcgtggtggagccgctgattggccgttccgtagag
gttccgccggcactggccgcactgctgcagcgcccagcgcatgccgaagcactggcgccg
gactacgccgcccttcggcagcgcttgcttgccgatgccacctga

DBGET integrated database retrieval system