KEGG   Xanthomonas citri pv. citri 306: XAC2045Help
Entry
XAC2045           CDS       T00084                                 

Gene name
hbdH1
Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00072  Synthesis and degradation of ketone bodies
xac00650  Butanoate metabolism
xac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    XAC2045 (hbdH1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    XAC2045 (hbdH1)
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     XAC2045 (hbdH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 Polysacc_synt_2 3HCDH_N RmlD_sub_bind RRM_occluded NmrA
Motif
Other DBs
NCBI-ProteinID: AAM36907
UniProt: Q8PKW2
Position
complement(2390001..2390759)
Genome map
AA seq 252 aa AA seqDB search
MHSILITGAGSGIGAGIATQLAADGHHLLVSDVQLAAAERTADALRQAGGSAEALALDVT
DADSIAQALASASRAPQVLVNNAGLQHVAALEEFPMQQWALLVDVMLTGAARLSRAVLPG
MRAAGYGRIVNIGSIHSLVASPYKSAYVAAKHGLVGLAKVIALETADCDITVNTLCPSYV
RTPLVERQIADQARIRGITEDAVVRDVMLKPMPKGAFIDYDELAGTVAFLMSHAARNITG
QALAIDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcatcctgatcaccggcgcgggcagcggcattggcgccggtatcgccacccaa
ctggcggccgacggccatcatctgctcgtcagcgatgtgcagctggcggccgccgagcgc
acggcggatgcgttgcgccaggcaggcggctcggcggaggcgctggcgttggacgtgacc
gatgcagacagcatcgcgcaggcactggccagtgcatcacgcgccccgcaggtactggtg
aacaacgccggcctgcagcatgtggccgcacttgaggagttcccgatgcagcagtgggcg
ctgctggtggatgtgatgctcaccggcgccgcacgcctcagtcgcgccgtgctgcccggc
atgcgcgcggccggctatggccgcatcgtcaatatcggcagcatccactcgctggtggcc
agcccatacaaaagtgcgtatgtggccgccaagcatggcctggtcggcctggccaaagtc
atcgcgctggaaaccgccgattgcgacatcaccgtcaacacgctctgccccagctatgtg
cgtacgccgctggtggaacggcagattgccgatcaggcgcgcatccgcggcatcaccgag
gacgccgtggtgcgcgatgtgatgctcaagccgatgcccaagggcgccttcatcgactac
gacgagctggccggcaccgtggcgtttctgatgtcgcatgccgcccgcaatatcaccggg
caagccctcgccatcgatgggggctggacggcacaatga

DBGET integrated database retrieval system