KEGG   Xanthomonas citri pv. citri 306: XAC2070Help
Entry
XAC2070           CDS       T00084                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00052  Galactose metabolism
xac00500  Starch and sucrose metabolism
xac00520  Amino sugar and nucleotide sugar metabolism
xac00521  Streptomycin biosynthesis
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
xac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC2070 (glk)
   00052 Galactose metabolism
    XAC2070 (glk)
   00500 Starch and sucrose metabolism
    XAC2070 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XAC2070 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XAC2070 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XAC2070 (glk)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XAC2070 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AAM36927
UniProt: Q8PKU2
Position
complement(2418338..2419345)
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADVDASVPLLDDTSREFAVVDFGSLGEAARYYLDQIGV
QATQGVFAVAGRVDGDEARITNHPWVISRSRTATMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIDQARNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRALSEIAGVDPGPLQPKDITARAAAGDPRS
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSKVPSLAVMHPHAGLLGAAAYAVDAQRQHPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccaagccggtgctggttgccgatatcggcggtaccaatgcgcgcttc
gcgctggccgatgtcgacgcctcggtgccgttgctggatgacacctcgcgcgaatttgcg
gtggtggatttcggttcgctgggcgaagcggcgcgctattacctggaccagatcggcgtg
caggccacccagggcgtgttcgccgtggcgggccgcgtggacggcgacgaggcacgcatc
accaaccatccctgggtgatctcgcgctcgcgcaccgccaccatgctgggtttcagtacc
ttgcatctgatcaacgactttgccgcgcaggcgatggcgatcagcctgctgcgtccacag
gacgtggtgcaggtaggcggcgccagctggcgtccggcaccgatcgatcaagcgcgcaac
tatggcgtgatcggcccgggcaccggcctgggcgtgggcggcctgatcatccgcaacggg
cgctgctttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gaaatccgcatcctggaaatcctgtccgagcagttcggccgggtctccaacgagcggctg
atctgcggtccgggcctggtcaatatccatcgcgcgttgagcgagatcgcgggggtcgat
ccgggcccgctgcaacccaaggacatcaccgcacgcgcggctgcgggcgacccgcggtcc
tcgcgcaccatcgatctgttctgcgccatcttcggtgcgatcgccggcgacatggtgctg
atgcagggcgcctgggacggcgtgttcctcaccggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggctttcgccagcgcttcgaacacaagggccgtttctccgcgatc
atgtcgaaggtgccatcgctggcggtcatgcacccgcatgccggcctgctgggcgccgcc
gcctacgcggtggatgcacaacgtcagcaccccggggagcagcgatga

DBGET integrated database retrieval system