KEGG   Xanthomonas axonopodis pv. citri 306: XAC2070Help
Entry
XAC2070           CDS       T00084                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC2070 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC2070 (glk)
   00052 Galactose metabolism
    XAC2070 (glk)
   00500 Starch and sucrose metabolism
    XAC2070 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XAC2070 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XAC2070 (glk)
   00524 Butirosin and neomycin biosynthesis
    XAC2070 (glk)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XAC2070 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2418338..2419345)
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADVDASVPLLDDTSREFAVVDFGSLGEAARYYLDQIGV
QATQGVFAVAGRVDGDEARITNHPWVISRSRTATMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIDQARNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRALSEIAGVDPGPLQPKDITARAAAGDPRS
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSKVPSLAVMHPHAGLLGAAAYAVDAQRQHPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccaagccggtgctggttgccgatatcggcggtaccaatgcgcgcttc
gcgctggccgatgtcgacgcctcggtgccgttgctggatgacacctcgcgcgaatttgcg
gtggtggatttcggttcgctgggcgaagcggcgcgctattacctggaccagatcggcgtg
caggccacccagggcgtgttcgccgtggcgggccgcgtggacggcgacgaggcacgcatc
accaaccatccctgggtgatctcgcgctcgcgcaccgccaccatgctgggtttcagtacc
ttgcatctgatcaacgactttgccgcgcaggcgatggcgatcagcctgctgcgtccacag
gacgtggtgcaggtaggcggcgccagctggcgtccggcaccgatcgatcaagcgcgcaac
tatggcgtgatcggcccgggcaccggcctgggcgtgggcggcctgatcatccgcaacggg
cgctgctttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gaaatccgcatcctggaaatcctgtccgagcagttcggccgggtctccaacgagcggctg
atctgcggtccgggcctggtcaatatccatcgcgcgttgagcgagatcgcgggggtcgat
ccgggcccgctgcaacccaaggacatcaccgcacgcgcggctgcgggcgacccgcggtcc
tcgcgcaccatcgatctgttctgcgccatcttcggtgcgatcgccggcgacatggtgctg
atgcagggcgcctgggacggcgtgttcctcaccggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggctttcgccagcgcttcgaacacaagggccgtttctccgcgatc
atgtcgaaggtgccatcgctggcggtcatgcacccgcatgccggcctgctgggcgccgcc
gcctacgcggtggatgcacaacgtcagcaccccggggagcagcgatga

DBGET integrated database retrieval system