KEGG   Xanthomonas citri pv. citri 306: XAC2292Help
Entry
XAC2292           CDS       T00084                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00040  Pentose and glucuronate interconversions
xac00052  Galactose metabolism
xac00500  Starch and sucrose metabolism
xac00520  Amino sugar and nucleotide sugar metabolism
xac01100  Metabolic pathways
xac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XAC2292 (galU)
   00052 Galactose metabolism
    XAC2292 (galU)
   00500 Starch and sucrose metabolism
    XAC2292 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XAC2292 (galU)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XAC2292 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAM37145
UniProt: Q8PK83
Position
complement(2682152..2683045)
Genome map
AA seq 297 aa AA seqDB search
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAK
AVVGNEPFAVLLPDDLMWNRGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAEL
LKEEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILREALAQADVRG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacagtgccgaaagaaatgctgccaatcatcgacaagccattgattcag
tacgccgtcgacgaagccatccaggctggttgcgatacgctgatcttcgtgaccaaccgc
tataagcactccatcgccgactacttcgacaaggcctatgagctcgagcagaagctggag
cgtgcaggcaagctggagcagctggagcttgtgcgccatgcgctgccggacggcgttcgc
gccatttttgtgacgcaggcggaagcgctgggtctgggtcatgcagtgctgtgtgccaag
gccgttgtcggtaacgaaccgttcgcggtgttgctgccggacgatctgatgtggaaccgc
ggtgatgctgcgctgacccagatggccaacgtggcggaagcctcgggcggcagcgtgatc
gccgtggaagacgtgccgcacgacaagaccgccagctacggcatcgtttccaccgacgca
ttcgacggccgcaagggccgcatcaacgcgatcgtcgaaaagcccaagccggaagtcgcg
ccaagcaacctggccgtggtcggtcgttacgtgctgagccccaagatcttcgacctgctc
gaagccaccggtgcaggcgcaggcggcgaaatccagctcaccgatgcgatcgccgaattg
ctgaaggaagagcaggtcgatgccttccgcttcgagggtcgccgtttcgattgcggcgcg
catatcggcctgatcgaagccaccgtgcattttgcgctcgagcacgaaaagcatggcggc
ccagcgaaggaaatcctgcgcgaagcactggcccaggccgacgtgcgcggctga

DBGET integrated database retrieval system