KEGG   Xanthomonas citri pv. citri 306: XAC2596Help
Entry
XAC2596           CDS       T00084                                 

Gene name
cgt
Definition
cyclomaltodextrin glucanotransferase
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
xac  Xanthomonas citri pv. citri 306
Brite
Enzymes [BR:xac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     XAC2596 (cgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3057336..3058961)
Genome map
AA seq 541 aa AA seqDB search
MAAPAAKDYYGTLEPFAAEAVYFVVTDRFVNGDTGNDHRDQGGAHRTFDVPTPCADGSED
NIGYLGGDFKGIVEHADYIRDLGFGAVWITPIVDNPDEAFTGGKPITCGSTLSDHGKTGY
HGYWGVNFYTLDEHLPSPGLDFAGFTRAMHASKLKVVLDIVGNHGSPAYTMPQAQPGFGK
LYDAQGRLVADHQNLAPAQLDPQHNPLHAFYNTGGGLAELSDLNENNPAVLDYLAGAYLQ
WMEQGADAFRIDTIGWMPDRFWHAFVARIREKRPGFFMFGEAFDYDANKIAGHTWTRNAG
VSVLDFPLKQQLAAVFGHEQAGFEKLAAPLFLRQGPYANPYALMSFYDNHDMARLDASDN
GFIDAHNWLFTARGIPVIYYGSEIGFMRGRAEHAGNRNYFGVERIRTAPQSPIFGPLQRI
AQVRRNTPALQRGVQVDVQLHGNQAAFLRVYQHAGTTQTALVLLNKADTAATIQVTRFLQ
PGAWRDAINGEQLQVQRGFATAVPAHGVRVLLSDAPITDPALRQQLDLQMAEQAARDARN
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcctgcagccaaggactactacggcaccctggagccgttcgccgccgaggcg
gtgtacttcgtggtgaccgaccgcttcgtcaacggcgataccggcaacgaccatcgcgat
cagggcggtgcgcatcgcaccttcgatgtgcccacaccatgcgccgacggcagcgaggac
aacatcggctatctcggtggcgacttcaagggcatcgtcgagcatgccgattacatccgc
gacctgggcttcggggcggtgtggatcaccccgatcgtcgacaaccccgacgaagcgttt
accggcggcaagccgatcacctgcggcagcacgctcagcgaccatggcaagaccggctat
cacggctattggggcgtcaacttctacacgctcgacgaacatctgcccagcccgggcctg
gatttcgccggctttacccgtgccatgcacgccagcaagctgaaggtcgtgttggacatc
gtggggaaccatggttcgccggcctacaccatgccgcaggcgcagcccggctttggcaag
ctctacgatgcacaggggcggctggtcgccgaccaccagaaccttgcgcccgcgcaactg
gatccgcagcacaacccattgcatgccttctacaacaccggcggcggcctggcggaattg
tccgacctcaacgaaaacaatccggcggtgctggattatctggccggcgcatacctgcag
tggatggagcagggcgccgatgcgtttcgcatcgataccatcggctggatgccggatcgc
ttctggcatgccttcgtggcgcgcatacgtgaaaaacgcccgggctttttcatgttcggc
gaagccttcgattacgacgccaacaagatcgccgggcatacctggacgcgcaatgccggc
gtcagcgtgctggatttcccgctgaaacagcagcttgccgcggtattcggtcatgaacag
gccggcttcgaaaaactcgccgcgcccttgttcctgcgtcaagggccctatgcgaacccc
tacgcgttgatgagcttctacgacaaccacgacatggcgcgtctggatgccagcgataac
gggtttatcgatgcgcacaactggttgttcaccgcccgcggcattccggtgatctattac
ggctcggaaatcggcttcatgcgtgggcgtgccgaacatgccggcaaccgcaattacttc
ggcgtcgagcgcattcgtaccgcaccgcagagcccgatcttcggcccgctgcaacgcatc
gcccaggtgcgtcgcaacaccccggcattgcagcgtggcgtgcaggtcgatgtgcagttg
cacggcaatcaagccgcgttcctgcgcgtctatcagcatgctggcacaacccaaaccgca
ttggtgctgctcaacaaggccgataccgcagccaccattcaagtgacgcgcttcctgcag
cccggcgcatggcgcgatgcgatcaatggcgagcagttgcaggtgcagcgtggtttcgca
acagcggtgccggcgcatggcgtgcgcgtgttgctgtcggatgcgccgatcaccgacccg
gccctgcgccagcagctcgacctgcagatggccgagcaggccgcgcgcgacgcgcgcaac
aggtag

DBGET integrated database retrieval system