KEGG   Xanthomonas citri pv. citri 306: XAC2707Help
Entry
XAC2707           CDS       T00084                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC2707 (tpiA)
   01230 Biosynthesis of amino acids
    XAC2707 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC2707 (tpiA)
   00051 Fructose and mannose metabolism
    XAC2707 (tpiA)
   00562 Inositol phosphate metabolism
    XAC2707 (tpiA)
Enzymes [BR:xac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XAC2707 (tpiA)
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XAC2707 (tpiA)
  Exosomal proteins of bladder cancer cells
   XAC2707 (tpiA)
  Exosomal proteins of melanoma cells
   XAC2707 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3166135..3166890)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRAFATELVAKVAAHMPLEGVEVVILPPLPYLGDLIEDFEAHHLSF
GAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHQESSELVARKFAAALHAGL
IPVLCVGESLEQREAGQTEAILRAQLDPVLALVGSAGFAGAVLAYEPIWAIGTGRTATPE
QAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgccggaaattggaagctgcatggcagccgcgccttcgccacc
gaactggtggccaaggtggccgcgcacatgcccctggagggtgtcgaagtcgtcatcctg
ccgccactgccttacctcggcgacctgatcgaggatttcgaggcccatcacctgtcgttc
ggagcccaggacgtcagcagtaacgagaagggcgcctacaccggcgaggtatcggcctcg
atgctggtcgatgtcggtgctggctacgggctggtcggccactccgagcgccgccaatac
catcaggagagtagcgaactggtagcgcgcaagttcgccgccgccctccatgccgggctg
attccggtgctgtgcgtgggcgaatcgctggaacagcgtgaagccggtcagactgaggca
atcctacgtgcccagctcgacccggtcctggcgctggtgggcagtgccggttttgcgggc
gcggtgctggcctacgaaccgatctgggccattggcaccggccgcaccgccaccccggag
caggcccaggcggtgcacgctttcctgcgtggcgaagtcgcgaaggcggatgctagaatc
gccgattcgttgcccatcctgtacgggggcagtgtcaagcccgacaacgccggcgagctg
ttcgcacagcctgacgtcgatggcgggctggtcggaggcgcatcactggtcgccgaagat
ttcctggccatcgcacgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system