KEGG   Xanthomonas citri pv. citri 306: XAC2717Help
Entry
XAC2717           CDS       T00084                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XAC2717 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XAC2717 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XAC2717 (trpB)
Enzymes [BR:xac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XAC2717 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3177394..3178611)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGQFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLQDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYVICD
DDGQITETHSISAGLDYPGVGPEHSFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPRDALVLCNLSGRGDKDVHTIAAREGIAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgccggccacttcggc
cagttcggtggccgtttcgtcgccgaaaccttgatcggcccgctgcaggaactgtccgcc
gcctacgatcaggcacggcaagatccgagtttcatcgccgaatacgacaaggacctcaag
cattacgtcggccggcccagcccgatctaccacgctgaacggctcagccgtgaagtgggt
ggggcgcagatcctgctcaagcgcgaagacctcaaccataccggcgcgcacaagatcaac
aacaccatcggccaggccctgctggccagccgcatgggcaagacccgcatcatcgccgag
accggcgccggccagcacggcgtcgccagtgccaccgtggcggcacgcctgggcctggaa
tgcgtggtctacatgggcgccaccgatatcgagcggcagaagatcaacgtctaccgcatg
aagttgctcggcgccacggtgatcccggtgacctccggctctgccacgctcaaggacgcg
ctcaacgaagccatgcgcgactgggtgaccaacgtgcgcgacaccttctacatcatcggc
accgtggctggcccggacccatacccgcgcatggtgcgcgacttcaacgccattgtcggc
cgcgaggcgcgcgaacagatgttgcaggactatggccggctgccggatgcgatcagtgcc
tgcgtgggcggcggcagcaacgcgatcggtttgttccatgccttcctcaatgatccgggc
gtcaagatctatggcgccgaagcggccggcgatggcatcgccactggccgccatgccgcc
tccatcgccgccgggcgcccgggcgtgctgcacggcaatcgcacctatgtgatctgcgac
gacgacggccagatcaccgagacccattcgatttccgctggcctggattaccccggtgta
ggcccggagcattcgtttctctcggacagcggtcgcgcggtgtatcagggcatcaccgac
gacgaggcgatggccgccttccatctgctggcgcataccgaaggcattcttgccgcgctc
gagtccagccatgcggtggcgcagtcgatcaagcttgcgcgcgagctgcccagggatgcc
ttggtgctatgcaatctgtcggggcgtggcgataaggatgtgcacaccatcgcggcgcgc
gaggggatcgctctttag

DBGET integrated database retrieval system