KEGG   Xanthomonas citri pv. citri 306: XAC2826Help
Entry
XAC2826           CDS       T00084                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    XAC2826
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC2826
  Lipid metabolism
   00071 Fatty acid degradation
    XAC2826
  Amino acid metabolism
   00350 Tyrosine metabolism
    XAC2826
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XAC2826
   00626 Naphthalene degradation
    XAC2826
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XAC2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3311871..3312941
Genome map
AA seq 356 aa AA seqDB search
MRMRAMHFERFEQVPEILQLPDPTPSDDGVVIKVAATGICRSDWHGWMGHDPDIALPHVP
GHEFAGEVVAMGKRISGFAIGTRVTVPFVSGCGRCAQCHGGNQHVCSNQFQPGFTAWGSF
AEYVAIDFAETNLVRLPESIDDATAASLGCRFATSFRAVVDQARTGPGEWVVVHGCGGVG
LSAVMIAAALGAQVVAVDIFDDKLAFAVECGAVATVNASKAADTVEAIREITKGGAHVSI
DALGSPATCFNSISNLRRRGRHVQVGLMLGEHATPRIPMAQVIGHELEIYGSHGMQAWRY
DAMLAMIQAGKIAPQRLIGKRVGLDEAIAVLTGMDATRDLGISVIDRFQPVSPPAS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtatgcgcgcaatgcacttcgagcgttttgaacaggttccggaaattctgcagctc
cccgacccgacgccaagcgatgacggcgtggtgatcaaggtggcagccaccggcatctgc
cgcagcgattggcacggctggatggggcacgatccggacatcgcattgccgcacgtaccg
ggacatgagttcgccggcgaagtggtcgccatgggaaaacgcatctcgggctttgcgatc
ggcacccgggtcaccgtgccgttcgtgtcagggtgcgggcgctgcgcgcagtgccatggc
ggcaatcagcacgtgtgctcgaaccagttccagcccggcttcaccgcatggggatcgttc
gccgaatatgtcgcgatcgattttgccgagacgaatctggtcagactgccggaaagcatc
gacgatgcgacggcggcaagcctgggatgccggtttgccacctcgttccgggccgtggtc
gatcaggccagaaccggcccaggggaatgggtcgtggtccatggctgcggcggcgtcggg
ctttcggcagtgatgatcgcagcggcgctgggggcgcaggtggttgcggtggacatcttc
gacgacaagctggcgttcgccgtcgaatgcggcgcggtcgcaacggtcaacgcgtcgaaa
gcggccgacacggtggaggcgattcgcgagatcaccaagggcggcgcgcacgtttccatc
gatgcgctcggcagccccgcgacctgtttcaactccatcagcaacctgcggcggcgcggc
cgtcatgtccaggtgggactgatgctgggcgaacacgccacgcccaggatcccgatggcg
caggtgatcggccacgaactggagatctacggcagccacgggatgcaggcgtggcggtac
gatgccatgttggcgatgatccaggccgggaagatcgcacctcaacggctcatcggcaaa
agagtgggcctggacgaggccattgcggtgctgaccggcatggacgctacgcgcgacctc
ggcatcagcgtcatcgatcgcttccagcccgtatcgccgccggcatcctag

DBGET integrated database retrieval system