KEGG   Xanthomonas citri pv. citri 306: XAC2826Help
Entry
XAC2826           CDS       T00084                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00071  Fatty acid degradation
xac00350  Tyrosine metabolism
xac00625  Chloroalkane and chloroalkene degradation
xac00626  Naphthalene degradation
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
xac01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC2826
  Lipid metabolism
   00071 Fatty acid degradation
    XAC2826
  Amino acid metabolism
   00350 Tyrosine metabolism
    XAC2826
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XAC2826
   00626 Naphthalene degradation
    XAC2826
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XAC2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Urocanase 2-Hacid_dh_C ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AAM37671
UniProt: Q8PIR9
Position
3311871..3312941
Genome map
AA seq 356 aa AA seqDB search
MRMRAMHFERFEQVPEILQLPDPTPSDDGVVIKVAATGICRSDWHGWMGHDPDIALPHVP
GHEFAGEVVAMGKRISGFAIGTRVTVPFVSGCGRCAQCHGGNQHVCSNQFQPGFTAWGSF
AEYVAIDFAETNLVRLPESIDDATAASLGCRFATSFRAVVDQARTGPGEWVVVHGCGGVG
LSAVMIAAALGAQVVAVDIFDDKLAFAVECGAVATVNASKAADTVEAIREITKGGAHVSI
DALGSPATCFNSISNLRRRGRHVQVGLMLGEHATPRIPMAQVIGHELEIYGSHGMQAWRY
DAMLAMIQAGKIAPQRLIGKRVGLDEAIAVLTGMDATRDLGISVIDRFQPVSPPAS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtatgcgcgcaatgcacttcgagcgttttgaacaggttccggaaattctgcagctc
cccgacccgacgccaagcgatgacggcgtggtgatcaaggtggcagccaccggcatctgc
cgcagcgattggcacggctggatggggcacgatccggacatcgcattgccgcacgtaccg
ggacatgagttcgccggcgaagtggtcgccatgggaaaacgcatctcgggctttgcgatc
ggcacccgggtcaccgtgccgttcgtgtcagggtgcgggcgctgcgcgcagtgccatggc
ggcaatcagcacgtgtgctcgaaccagttccagcccggcttcaccgcatggggatcgttc
gccgaatatgtcgcgatcgattttgccgagacgaatctggtcagactgccggaaagcatc
gacgatgcgacggcggcaagcctgggatgccggtttgccacctcgttccgggccgtggtc
gatcaggccagaaccggcccaggggaatgggtcgtggtccatggctgcggcggcgtcggg
ctttcggcagtgatgatcgcagcggcgctgggggcgcaggtggttgcggtggacatcttc
gacgacaagctggcgttcgccgtcgaatgcggcgcggtcgcaacggtcaacgcgtcgaaa
gcggccgacacggtggaggcgattcgcgagatcaccaagggcggcgcgcacgtttccatc
gatgcgctcggcagccccgcgacctgtttcaactccatcagcaacctgcggcggcgcggc
cgtcatgtccaggtgggactgatgctgggcgaacacgccacgcccaggatcccgatggcg
caggtgatcggccacgaactggagatctacggcagccacgggatgcaggcgtggcggtac
gatgccatgttggcgatgatccaggccgggaagatcgcacctcaacggctcatcggcaaa
agagtgggcctggacgaggccattgcggtgctgaccggcatggacgctacgcgcgacctc
ggcatcagcgtcatcgatcgcttccagcccgtatcgccgccggcatcctag

DBGET integrated database retrieval system