KEGG   Xanthomonas citri pv. citri 306: XAC2870Help
Entry
XAC2870           CDS       T00084                                 

Gene name
cheB
Definition
(GenBank) protein-glutamate methylesterase
  KO
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XAC2870 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XAC2870 (cheB)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XAC2870 (cheB)
Two-component system [BR:xac02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   XAC2870 (cheB)
Bacterial motility proteins [BR:xac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XAC2870 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3367781..3368839
Genome map
AA seq 352 aa AA seqDB search
MVVDDSAVVRQVLVGVLNDAPGIDVIATAADPLLAIEKMRQHWPDVIVLDVEMPRMDGIT
FLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVVTKPRLGLKQFLTDSADELVAT
VRSAARANVKRLAARVTAAPLEAEVKHTADVILPAQSGRALAQTTERIVAIGTSTGGTQA
LEEVLTALPRVCPGIVIVQHMPEKFTAAFAARLNGLCQIAVKEAANNDRVMPGRALIAPG
GKHLLLRRSGAQYFVEVLEGPPVNRHRPSVDVLFRSAARAAGSNALGIIMTGMGDDGAAG
LLEMRQAGARTVAQDEHTSIVFGMPKEAIKRGGADRILPLGAMAREIVTQLQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcgacgattcggcagtggtgcgccaggtgctggtgggcgtgctcaacgacgcg
ccgggcatcgacgtcatcgccactgccgccgacccgctgctggcgatcgaaaaaatgcgc
cagcactggccggatgtgatcgtgctcgacgtggaaatgccgcgcatggacggcatcacc
tttctgcgcaagatcatgagcgagcggcccacgccggtggtgatctgctccacgctcacc
gaaaaaggcgcgcgcgtcaccatggatgcgctggccgccggcgcggtggcggtggtgacc
aaaccccgcctgggtctgaagcaatttctcaccgactctgccgacgaactggtggcgacc
gtgcgcagcgccgcgcgcgccaacgtcaagcggctggccgcgcgcgtgactgccgcgccg
ctggaagcggaggtcaagcacaccgccgatgtcatcctgccggcgcaaagcgggcgtgcg
ctggcgcagaccaccgaacgcatcgtcgccatcggcacctccaccggcggtacccaggcc
ctggaagaagtgctcaccgcgctgccgcgcgtctgcccgggcatcgtgatcgtgcagcac
atgccggagaaattcaccgctgccttcgccgcacgtctgaacggcctgtgccagatcgcc
gtcaaggaagccgccaacaacgaccgcgtgatgccgggccgcgcattgatcgcacccggc
ggcaaacatctgctgctgcgtcgcagcggcgcgcagtatttcgtcgaagtgctggaaggc
ccaccggtcaaccggcatcgcccgtcggtcgacgtactgttccgctcggccgcgcgcgcg
gccggcagcaatgcgctgggcatcatcatgaccggcatgggcgacgatggtgccgccggc
ctgctggaaatgcgccaggccggcgcacgcacggtggcgcaggacgaacacaccagcatc
gtgttcggcatgcccaaggaagcgatcaagcgcggcggcgcggaccgtatcctgccgctg
ggcgcgatggcgcgcgagatcgtgacgcagctgcaataa

DBGET integrated database retrieval system