KEGG   Xanthomonas axonopodis pv. citri 306: XAC2870Help
Entry
XAC2870           CDS       T00084                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xac02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xac02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3367730..3368839
Genome map
AA seq 369 aa AA seqDB search
MSTALHRPAANPAPIKAMVVDDSAVVRQVLVGVLNDAPGIDVIATAADPLLAIEKMRQHW
PDVIVLDVEMPRMDGITFLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVVTKPR
LGLKQFLTDSADELVATVRSAARANVKRLAARVTAAPLEAEVKHTADVILPAQSGRALAQ
TTERIVAIGTSTGGTQALEEVLTALPRVCPGIVIVQHMPEKFTAAFAARLNGLCQIAVKE
AANNDRVMPGRALIAPGGKHLLLRRSGAQYFVEVLEGPPVNRHRPSVDVLFRSAARAAGS
NALGIIMTGMGDDGAAGLLEMRQAGARTVAQDEHTSIVFGMPKEAIKRGGADRILPLGAM
AREIVTQLQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacagcgctccatcgccccgccgccaaccccgctcccatcaaggccatggtggtc
gacgattcggcagtggtgcgccaggtgctggtgggcgtgctcaacgacgcgccgggcatc
gacgtcatcgccactgccgccgacccgctgctggcgatcgaaaaaatgcgccagcactgg
ccggatgtgatcgtgctcgacgtggaaatgccgcgcatggacggcatcacctttctgcgc
aagatcatgagcgagcggcccacgccggtggtgatctgctccacgctcaccgaaaaaggc
gcgcgcgtcaccatggatgcgctggccgccggcgcggtggcggtggtgaccaaaccccgc
ctgggtctgaagcaatttctcaccgactctgccgacgaactggtggcgaccgtgcgcagc
gccgcgcgcgccaacgtcaagcggctggccgcgcgcgtgactgccgcgccgctggaagcg
gaggtcaagcacaccgccgatgtcatcctgccggcgcaaagcgggcgtgcgctggcgcag
accaccgaacgcatcgtcgccatcggcacctccaccggcggtacccaggccctggaagaa
gtgctcaccgcgctgccgcgcgtctgcccgggcatcgtgatcgtgcagcacatgccggag
aaattcaccgctgccttcgccgcacgtctgaacggcctgtgccagatcgccgtcaaggaa
gccgccaacaacgaccgcgtgatgccgggccgcgcattgatcgcacccggcggcaaacat
ctgctgctgcgtcgcagcggcgcgcagtatttcgtcgaagtgctggaaggcccaccggtc
aaccggcatcgcccgtcggtcgacgtactgttccgctcggccgcgcgcgcggccggcagc
aatgcgctgggcatcatcatgaccggcatgggcgacgatggtgccgccggcctgctggaa
atgcgccaggccggcgcacgcacggtggcgcaggacgaacacaccagcatcgtgttcggc
atgcccaaggaagcgatcaagcgcggcggcgcggaccgtatcctgccgctgggcgcgatg
gcgcgcgagatcgtgacgcagctgcaataa

DBGET integrated database retrieval system