KEGG   Xanthomonas citri pv. citri 306: XAC2874Help
Entry
XAC2874           CDS       T00084                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC2874 (gpmA)
   01230 Biosynthesis of amino acids
    XAC2874 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC2874 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XAC2874 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XAC2874 (gpmA)
Enzymes [BR:xac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XAC2874 (gpmA)
Exosome [BR:xac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XAC2874 (gpmA)
  Exosomal proteins of melanoma cells
   XAC2874 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3373708..3374457)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGRLMKDEGLQFDVAHTSVLK
RAIHTLQGALKELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVNDPGHPCHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDVSNEQILELNIPTGIPLLFELDDSLQVRSFRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaatctggacaaccgt
ttcaccggctgggtggatgtggaactcaccgaccagggccgccaggaagctgtggcggcc
ggcaggctgatgaaggacgaagggctgcagttcgatgtcgcccacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcgttgaaggaactcgaccaggactggttgccggtg
tccaagagctggcgcctcaacgagcgccactacggtggcctgcaaggcctggacaaggcc
gaaaccgcggcaaagcacggcgaggagcaggtcaagatctggcgccgttcctacgacatc
ccgccgccggcgatggacgtcaacgacccgggccacccgtgccacgaccgtcgctacgcc
acgctggaccgcaatgcattgccaggcaccgagtcgctggcgaccacgctggtgcgcgtg
ttgccgtattggcacgacgcgattgcgccgcagttgaaggccgggcagaccgtgctggtg
accgcgcacggcaattcgctgcgcgcgctctacaagtacctcaacgatgtctccaatgag
cagatcctggagctcaacatccccaccggcatcccgttgctgttcgagctggacgacagc
ctgcaggtgcgcagcttccgttacctgggcgacccggaggcggccaagcgcgcggccgaa
gcggtggccaatcagggcaaggcgaagtaa

DBGET integrated database retrieval system