KEGG   Xanthomonas axonopodis pv. citri 306: XAC2916Help
Entry
XAC2916           CDS       T00084                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xac00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xac00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3424234..3425181)
Genome map
AA seq 315 aa AA seqDB search
MTTMQLDSDGRLRHLLTLEGLPRTTLLQLLDRAGQIRDAAVGRVGKRSVLAGTAVCTLFF
EPSTRTRSSFHLAAQRLGADVLNFDASTSSTRKGETARDTLKNLEAMGVRGFVVRHPDDG
AVEALAAAAGEGTALINAGDGRSAHPTQGLLDMLTLRQAKGTDFSKLKVVIVGDVKHSRV
ARSDLHALRTLGAGEIRVCGPVSLLPDDGMLEGCVVGQDFDAMLEGADALMMLRLQRERM
EEGLVPSLEQYHTEYGLTCERLARAGRDAAVLHPGPINRGVEITDEVADGAQSCVLRQVA
NGVAVRMAVLETLLG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatgcaactcgattcggacggacgcttgcgccacctgctcaccctggaagga
cttccgcgcaccacgctgctgcaattgctcgaccgcgccggccagatccgcgatgcagcg
gtcgggcgcgtgggcaagcgcagcgtgctggcgggcactgcagtgtgcacgctgttcttc
gagccctccacgcgcacgcgcagctccttccatctggcggcgcagcggctgggcgcggac
gtgctcaatttcgatgcatccacctcatccacccgcaagggcgaaaccgcgcgcgatact
ttgaagaatctcgaagcgatgggcgtgcgcggcttcgtggtgcgtcaccccgacgacggc
gcggtggaagcgctggcggctgccgcgggcgagggcaccgcgttgatcaatgccggcgac
ggacgtagcgcgcatcccacccagggcttgctcgacatgctcaccctgcgccaggccaag
ggcaccgatttttccaagctcaaggtcgttatcgtcggcgacgtgaagcactcgcgcgtg
gcgcgctcggacctgcatgccttgcgcacgttgggcgctggcgaaatccgcgtctgcggc
ccggttagcctgctgcctgacgacggcatgctggagggctgcgtggtcggtcaggatttc
gatgccatgctcgaaggcgccgacgcgctgatgatgctgcgcctgcagcgcgagcgcatg
gaagaaggcctggtgccctcgctggagcagtaccacaccgaatatggtctgacctgcgag
cgcctggcgcgtgccggtcgtgacgccgcggtgctgcacccgggcccgatcaaccgcggc
gtggaaatcaccgatgaagtggccgacggcgcgcaatcctgcgtgctacggcaggtcgcc
aacggcgtcgccgtgcgcatggccgtgctggaaaccctgctcggctga

DBGET integrated database retrieval system