KEGG   Xanthomonas citri pv. citri 306: XAC2965Help
Entry
XAC2965           CDS       T00084                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00520  Amino sugar and nucleotide sugar metabolism
xac00550  Peptidoglycan biosynthesis
xac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XAC2965 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XAC2965 (murA)
Enzymes [BR:xac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     XAC2965 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:xac01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   XAC2965 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AAM37810
UniProt: Q8PID3
Position
complement(3468970..3470244)
Genome map
AA seq 424 aa AA seqDB search
MAKIVVTGGQALHGEVHISGAKNAVLPILCATLLADAPVEISNVPHLHDVITTVKLLSEL
GAEVTIDEGTLAKGRSMLVDPRSVTHQVAPYELVKTMRASILVLGPLLARYGTAEVSLPG
GCAIGSRPVDQHIKGLQALGADISVENGYIKATSNGRLKGARYVFDMVSVTGTENVLMAA
VLAEGTTVLENAAMEPEVTDLADCLIALGARIEGAGTPRIVVQGVERLGGGHHAVLPDRI
ETGTFLVAAAMTGGSVTVRRARPETLDAVLDKLTEAGATITTTADSITLDMQGKRPRAVS
LTTAPYPAFPTDMQAQFMALNCVADGVGVINETIFENRFMHVNELLRLGADIQVEGHTAI
VRGAERLSGAPVMATDLRASASLILAGLVADGDTTIDRIYHLDRGYENIEEKLGALGATI
QRTA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcgtagtgaccggcggccaagcgctgcatggcgaagtccatatttccggt
gccaagaacgcagtgctgccgatcctgtgcgcgaccctgctggccgacgcgccagtggaa
atcagcaacgtgccgcatctgcacgacgtgatcaccacggtgaaattgctcagcgagctg
ggcgccgaggtcaccatcgacgaaggcacgctggccaagggccgctcgatgctggtcgac
ccgcgctcggtcacccatcaggttgcgccgtatgagctggtcaagaccatgcgtgcctcg
atcctggtgttgggcccgctgctggcgcgctacggcactgcagaagtctcgctgcccggc
ggttgcgcgatcggttcgcgcccggtggaccagcacatcaagggcctgcaggcactgggt
gccgacatcagcgtggaaaacggctacatcaaggccaccagcaatggccgcctgaagggt
gctcgctacgtattcgacatggtcagcgtcaccggcaccgagaacgtgctgatggctgcg
gtgctcgccgagggcaccacggtgctggaaaatgcggcgatggagccggaagtcaccgac
ctggccgactgcctgatcgcactcggtgcgcggatcgaaggcgccggcaccccgcgcatc
gtggtgcaaggcgtcgagcggctgggcggcgggcaccatgcggtgctgccggaccgcatc
gaaaccggtaccttcctggtcgctgcggcgatgaccggcggcagcgtcaccgtgcgccgc
gcgcgcccggaaacgctggacgcagtactggacaagctgaccgaggctggcgccaccatc
accaccaccgccgacagcatcacgctggacatgcaaggcaagcgcccgcgcgcggtcagc
ctgaccaccgcgccgtacccggcgtttcccaccgacatgcaggcgcaattcatggcgctc
aactgcgtggccgatggcgtgggcgtgatcaacgaaaccatcttcgaaaaccgcttcatg
cacgtcaacgagctgctgcgcctgggcgcggatatccaggtcgaaggtcataccgccatc
gtgcgcggtgccgaacgcctgagcggcgcgccggtgatggcgaccgacctgcgcgcgtcg
gcgtcgctgatcctggcaggcctggtcgccgatggcgacaccaccatcgatcgcatctac
cacctggaccgtggctacgaaaacatcgaggagaagctgggggcgctgggcgcgaccatc
cagcgcaccgcatga

DBGET integrated database retrieval system