KEGG   Xanthomonas citri pv. citri 306: XAC3066Help
Entry
XAC3066           CDS       T00084                                 

Gene name
cysQ
Definition
(GenBank) sulfite synthesis pathway protein
  KO
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XAC3066 (cysQ)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     XAC3066 (cysQ)
Transfer RNA biogenesis [BR:xac03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    XAC3066 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3587281..3588066)
Genome map
AA seq 261 aa AA seqDB search
MELRETVIAIARDAGDAIMEVYAQDFSVEIKDDASPLTQADLAANRVIVEGLRRVTPDVP
VLSEESAHVAWEQRQYWTSYWLVDPLDGTREFVKRNGEFSVNIALIHMGAPVLGVVQAPV
DGRVWYAARGENAFRRDGDRDEMLHTRTPAAMPLRVAASRSHRDARTAAALERMGEIDVV
AQGSSLKFCRIAEGDLDVYPRFGPTSEWDTAAGQCVLHAAGGVLLAGASGKPFRYNRRDT
LLNGDFIALGDPNLPWRDWLA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgcgaaaccgtgatcgccatcgcgcgcgacgccggcgacgcaatcatggag
gtctacgcccaggacttttcggtggagatcaaggacgacgccagcccgctgacccaggcc
gacctggcggccaaccgcgtcatcgtcgaaggcctgcgccgtgtcaccccggatgtgccg
gtgctgtcggaagagtctgcgcacgtggcctgggagcaacgccagtactggaccagttac
tggctggtcgatccgctcgatggcacccgcgaattcgtcaagcgcaatggcgagttcagc
gtcaacatcgcactcatccatatgggcgcgccggtgctgggggtggtgcaggcgccggtc
gacggacgggtctggtatgccgcgcgtggcgagaacgccttccgccgcgatggcgaccgc
gatgagatgctgcacacgcgcaccccggccgccatgccgttgcgggtggcagccagccgt
tcgcatcgcgacgcgcggactgccgccgcgctggagcggatgggcgagatcgacgtggtc
gcgcaaggctcgtcgttgaagttctgccgcatcgccgaaggcgatctggacgtgtatccg
cgcttcggccccacctccgagtgggacaccgccgccggccagtgcgtgctgcatgcggcc
ggtggcgtgttgctggccggcgccagcggcaaaccgttccgctacaaccgccgcgacacc
ttgctcaacggcgacttcatcgcactgggcgaccccaatctgccctggcgcgattggctg
gcctga

DBGET integrated database retrieval system